SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017027 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017027
Domain Number 1 Region: 1370-1539,1608-1673,1739-1838
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 5.82e-116
Family Mammalian PLC 0.00000577
Further Details:      
 
Domain Number 2 Region: 236-452,502-719,747-844
Classification Level Classification E-value
Superfamily Ras GEF 2.75e-40
Family Ras GEF 0.0055
Further Details:      
 
Domain Number 3 Region: 2124-2233
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.17e-35
Family Ras-binding domain, RBD 0.00000175
Further Details:      
 
Domain Number 4 Region: 1998-2104
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.96e-33
Family Ras-binding domain, RBD 0.00000198
Further Details:      
 
Domain Number 5 Region: 1864-1975
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.57e-22
Family PLC-like (P variant) 0.0031
Further Details:      
 
Domain Number 6 Region: 1186-1217,1300-1358
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000231
Family EF-hand modules in multidomain proteins 0.032
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000017027
Domain Number - Region: 849-890,924-1000
Classification Level Classification E-value
Superfamily PH domain-like 0.0332
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017027   Gene: ENSMPUG00000017136   Transcript: ENSMPUT00000017281
Sequence length 2292
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896923.1:9697485:10015146:-1 gene:ENSMPUG00000017136 transcript:ENSMPUT00000017281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSEEMAASVLTPVTQRKVTSTPSAIDESSEKVSDISVLKAHSIRQSGQTSTTAQMNKLN
EEPSGSNLPKILSIAREKIVSDENSNEECWTESTPVSVENLNINQNNVLTKSQCYDMCDS
VMEEDPYLETGIPSSLEREVFPGIQLEIDGPPMDISPLGSQSAVIETGQAHPDGNTAAFH
FHYEVDRRVSDTFCTLSGNLILDDCGNCVPLPDVGGEQKKNYAAYTCKLMELAENCDNKN
GQLQCDHCDTLDDNYLCFEGSCRRASVLCSSDSLCREDLTNSPPAKTFLSHFEDFPDNCE
DVEEDFFKSKKERSTLLVRRFCKNDREIKKSVYTGTRAIMRTLPSGHIGLEAYSYIDQKR
SGLLLPCGRVLEQLSVVAIRQDGSQCLSEAQWYRIYNAVRSREEIENTIESLLHVFTNLP
ASEAAHERISIGPCLKQCVQDTICEYRATLQRTSISQYITGSLLEATTSLGARSGLLSTF
GGSTGRMMLKERQPGTSMANSSALPSSSAGISKELIDLQPLIQFPEEVASILMEQEQNIY
RRVLPVDYLCFLTRDLGTPECQTSLPCLKASISASILTSQNGEHNALEDLVMRFNEVSSW
VTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMDQSD
LETMRSLKDAMAQHESSCEYRKVVTRALHIPGCKVVPFCGVFLKELCEVLDGASGLMKLC
PRYNSQEETLEFVADYSGQDNFLQRVGHNGLKNSEKESTVNSIFQTIRSCSRSLEAEDED
SPSEGNSSRKNSLRDKARWQFIIGDLLDSENDIFEQSKEWDSHGSEEPQKAFDHGTELIP
WYVLSIRADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWIKPTTASPASAKAK
LGVLSNTSEPGKFPLLGNAGLSGLAEGVLDLFSAKAVYMGHPSIDIHTVCVQNKLGSMFL
SETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTRAVRKMRKFPDQRQQWLRKQY
VSLYQEDGRYEGPTLAHAVELFGGRRWSTRNPSPGTSAKSAEKPSVQRNNTLGISTTKKK
KKILIRGESGEAADDEMATRKAKMQRESRSRSGSDPQDVNEQEESEANAVMSPPNTLPSR
RAHSLTTAGSPNLSAGVSSPISAWSSSSWHGRIKGGMKGFQSFMVSDSNMSFVEFVELFK
SFSVRSRKDLKDLFDIYAVPCSRAGSESAPLYTNLTIDENTSDLQPDLDLLTRNVSDLGL
FIKSKQQLSDNQRQISDAIAAASIVTNGTGVESTSLGIFGVGILQLNDFLVNCQGEHCTY
DEILSIIQKFEPSVSMCHQGLLSFEGFARFLMDKDNFASKNDESQEDIKDLQLPLSYYYI
ESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPIIYHGHTLTTKIPFK
EVVEAIDRSAFINSDLPIIISIENHCSLPQQRKMAEIFKTVFGEKLVAKFLFESDFSDDP
MLPSPDQLRRKVLLKNKKLKAHQTPVDILKQKAHQLASMQAQAYNGGNANPPPANNEEEE
DEEDEYDYDYESLSDADVLTASPAPNSQEDNILEDRPENKSCNDKLQFEYNEEIPKRIKK
ADNSACNKGKVYDMELGEEFYLPQNKKESRQIAPELSDLVIYCQAVKFPGLSTLNASGSS
RGKERKSRKSIFGNNPGRMSPGETASFNKASGKSSCEGMRQAWEESSSPLNPTTSLSAII
RTPKCYHISSLNENAAKRLCRRYSQKLIQHTACQLLRTYPAATRIDSSNPNPLMFWLHGI
QLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKNCPMYQKFSPLERDLDNMEPA
VYSLTIVSGQNVCPNSSTGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFRVH
FEDLIFLRFAVVENNSSAVTAQRIIPLKALKRGYRHLQLRNLHNEVLEISSLFINSRRME
ENSSSSAVPASLMFNTEERKCLQTHKVTVHGVPGPEPFTVFSINGGTKAKQLLQQILTTE
QNTKPIVTDYFLMEEKFFISKEKNECRKQPFQRVIGPEEEIMQILSSWFPEEGYVGRIVL
KTQQENLEERSIIQDDKEVILSSEEESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQTL
CKAKYSYSILSNPNPSDYVLLEEVVKDATKKSSTPKSSQRVLLDQECVFQAQSKWKGAGK
FILKLKEQVQASREDRRKGISFASEFKKFTKSTKQPRGLTSSSLVLASESVQSKEEKPVG
SLPSSDAIDYRQ
Download sequence
Identical sequences M3Z0B6
ENSMPUP00000017027 ENSMPUP00000017027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]