SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017032 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017032
Domain Number 1 Region: 470-825
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.04e-114
Family PDEase 0.000000232
Further Details:      
 
Domain Number 2 Region: 42-237
Classification Level Classification E-value
Superfamily GAF domain-like 6.62e-30
Family GAF domain 0.00048
Further Details:      
 
Domain Number 3 Region: 223-268,295-444
Classification Level Classification E-value
Superfamily GAF domain-like 7.06e-30
Family GAF domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017032   Gene: ENSMPUG00000017141   Transcript: ENSMPUT00000017286
Sequence length 846
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896923.1:10308071:10355253:-1 gene:ENSMPUG00000017141 transcript:ENSMPUT00000017286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEISQEAVEKYLEDHPQFAKEYLAQRLGEAPGDSGPLSSAEEWALCSELMLAMQEEAAS
PELTVHRALGKLAQLLQADRCSFFACRARNGTPEVASRLLDITPTSRFEDSLVVPKREVV
FPLDIGIVGWVAHTKKAINVPDVQKNSHFSDFMDKQTGYVTKNLLATPIVMGKEVLAVVM
AINKVNASEFSKQDEEIFCKYLNFVSVILKLHHTNYLYSIESRRSQILMWSANKVFEELT
DVERQFHKALYTVRTYLNCERYSIGLLDMTKEKEFYDEWPIKLGEVEPYKGPKTPDGREV
IFYKIIDYILHGKEEIKVIPTPPADHWTLVSGLPTYVAENGFICNMLNAPADEYFTFQKG
PVDETGWVIKNVLSLPIVNKKEDIVGVATFYNRKDGKPFDEYDEHITETLTQFLGWSLLN
TDTYDKMNKLENRKDIAQEMLMSQTKATPDEIKSILKIKEKLNTDVIEDCEEKQLITILK
EDLPDPQAVDLYEFRFSDFPITEHELIKCGLRLFFEINVVEKFKVPVEVLTRWMYTVRKG
YRSITYHNWRHGFNVGQTMFTLLMTGRLKKYYTDLEAFAMLAAAFCHDIDHRGTNNLYQM
KSTSPLAKLHGSSILERHHLEYSKTLLQDESLNIFQNLNKRQFETVIHLFEVAIIATDLA
LYFKKRTMFQKIVDACEKMETEEEAIKYVTIDPTKKEVIMAMMMTACDLSAITKPWEVQS
QVALLVANEFWEQGDLERTVLQQQPIPMMDRNKKDELPKLQVGFIDFVCTFVYKEFSRFH
KEITPMLNGLQNNRVEWKSLADEYDAKMKVLEEEMKKQEEGNTTTKATEDIGGGSDDKKS
KTCLML
Download sequence
Identical sequences M3Z0C1
XP_004749700.1.14098 ENSMPUP00000017032 ENSMPUP00000017032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]