SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017033 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017033
Domain Number 1 Region: 526-636,670-719
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.37e-31
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017033   Gene: ENSMPUG00000017142   Transcript: ENSMPUT00000017287
Sequence length 741
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896963.1:3864930:3891393:-1 gene:ENSMPUG00000017142 transcript:ENSMPUT00000017287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIKGQFWNDDDSEGDNESEEFLYGVQGSCAADLYRHPQLDADIEAVKEIYSENSVSIRE
YGTIDDVDIDLHINISFLDQTVVCTVMVLRTEPIVLRLRFSLSQYLDGPEPSIEVFQPSN
KEGFGLGLQLKKMDKSFPCRQTLRSKGKSNCNGVAKIETGLQLSFSPLRKLFWSMRPGNG
SGYLTSKVKRYFRTAHFHVLRPSRKRGTVGSRQVVPSRSSELASASSRPSPSPLNSASLT
IHPHSRVPSPCPLCKINNCLVLCPHAFILCPCSSEAHSVSPVSSLLFCFLSRSPSFPIIQ
DSMLKGKLGVPELRVGRLMNRSISCTMKNPKVEVFGYPPSPQAGLLCPQHVGLPPPARTS
PLVSGHCKNIPTLEYGFLVQIMKYAEQRIPTLNEYCVVCDEQHVFQNGSMLKPAVCTREL
CVFSFYTLGVMSGAAEEVATGAEVVDLLVAMCRAALESPRKSIIFEPYPSVVDPTDPKTL
AFNPKKKNYERLQKALDSVMSIREMTQGSYLEIKKQMDKLDPLAHPLLQWIISSNRSHIV
KLPLSRQLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENWHSILRNGLV
NASYTKLQLHGAAYGKGIYLSPISSISFGYSGMGKGQHRMPSKDELVQRYNRMNTIPQTR
SIQSRFLQSRNLNCIALCEVITSKDLQKHGNIWVCPVSDHVCTRFFFVYEDGQVGDANIN
TQDPKIQKEIMRVIGTQVYTN
Download sequence
Identical sequences M3Z0C2
ENSMPUP00000017033 ENSMPUP00000017033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]