SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017064 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017064
Domain Number 1 Region: 435-657
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.1e-56
Family DBL homology domain (DH-domain) 0.00018
Further Details:      
 
Domain Number 2 Region: 220-354
Classification Level Classification E-value
Superfamily BRCT domain 9.01e-23
Family DNA topoisomerase II binding protein 1, TopBP1 0.058
Further Details:      
 
Domain Number 3 Region: 139-252
Classification Level Classification E-value
Superfamily BRCT domain 1.78e-18
Family DNA ligase 0.031
Further Details:      
 
Domain Number 4 Region: 648-793
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000387
Family Pleckstrin-homology domain (PH domain) 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017064   Gene: ENSMPUG00000017173   Transcript: ENSMPUT00000017318
Sequence length 914
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896952.1:5471855:5533980:1 gene:ENSMPUG00000017173 transcript:ENSMPUT00000017318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADNSVLTSTTGRTSLADSSIFDSKVTEISKENVFVGSASYVEEEMPQIETRMILVQEAG
KQEELIKALKTIKIMEVPVIKIRESCPGKSDEKLIKSVVNMEIKVPFVKMESLEEFESLD
SPEFENVFIVMDFQDSIFDELHKTDCRIIGPPVILNCAQKGEPLPFSCRPLYCTSMMNLV
LCFTGFRKKEELVRLVTLVHHMGGVIRKDFNSKVTHLVANCTQGEKFRIAVSLGTPIMKS
EWIYKAWERRNEQDFCASVDDFRNEFKVPPFQDCILSFLGFSDEEKTNMEEMTKMQGGNC
LPVGDERCTHLVVEENVVKELPFEPSKKLYVVKQEWFWGSIQMDARAGETMYLYEKANTP
ELKKSVSLLSLNTPNSNRKRRRLKETLAQLSRETDMSPFPPRKRPSAEHSLSIGSLLDIS
NTPESSINYGETPKSCTKSSKNSTPVPSKQSARWQVAKELYQTESNYVNILATIIQLFQV
PLEEEGQRGGPILAPEEIKTIFGSIPDIFDVHMKIKDDLEDLIVNWDESKSIGDIFLKYS
KDLVKTYPPFVNFFEMSKETIIKCEKQKPRFHAFLKINQAKPECGRQSLVELLIRPVQRL
PSVALLLNDLKKHTAEENPDKSTLEKAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDG
CPANLLSSHRSLVQRVETISLGEHPCDRGEQVTLFLFNDCLEIARKRHKVIGTFRSPPGH
TRPPASLKHIHLMPLSQIKKVLDIRETEDCHNAFALLVRPPTERANVLLSFQMTSEELPK
ENWLKMLCRHVANTICKADAENLIYSADPESFEVNTKDMDSTLSRASRAIKKTSKKVTRA
FSFSKTPKRALRRALMTSQSSVEGRSPSSNDKHVMSRLSSTSSLAGIPSPSLVSLPSFFE
RRSHTLSRSTTHLI
Download sequence
Identical sequences M3Z0F2
ENSMPUP00000017064 XP_004756653.1.14098 ENSMPUP00000017064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]