SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017089 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017089
Domain Number 1 Region: 13-191,255-353
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.88e-42
Family WD40-repeat 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000017089
Domain Number - Region: 441-554
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000142
Family WD40-repeat 0.053
Further Details:      
 
Domain Number - Region: 699-715,797-892
Classification Level Classification E-value
Superfamily TPR-like 0.0284
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017089   Gene: ENSMPUG00000017197   Transcript: ENSMPUT00000017343
Sequence length 1245
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896899.1:35510781:35581354:1 gene:ENSMPUG00000017197 transcript:ENSMPUT00000017343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAVLTWRDKAEQCIYDLAFKPDGMQLILAAGNRLLVYDTSDGTLLQPLKGHKDTVYCVA
YAKDGKRFASGSADKSVIIWTSKLEGILKYTHNDSIQCVSYNPVTHQLASCSSSDFGLWS
PEQKSVTKHKSNSKITCCRNSWTNDGQYLALGMFNGIISIRNKNGEEKVKIERPGGSLSP
IWSICWNPSSRWESFWMNRESEDAEEVNVNRYFQEIPSTLKSAVYSSQGSEAEEEEPEEE
DDSPRDDNSEEHNDILAVADWGQKLSFYQLSGKQIGKDRSLNFDPCCLSYFTKGEYILLG
GSDKQVSLFTKDGVRLGTVGEQNSWVWTCKVKPDSNYVVVGCQDGTISFYQLIFSTVHGL
YKDRYAYRDSMTDVIVQHLITEQKVRIKCKELVKKIAIYKNRLAIQLPEKILIYELYSDD
SSDMHYRVKEKIVKKFECNLLVVCADHIILCQEKRLQCLSFSGVKEREWQMESLIRYIKV
IGGPPGREGLLVGLKNGQILKIFVDNLFAIVLLKQATAVRCLDMSASRNKLAVVDENDTC
LVYDIHTKELLFQQPQSHLLVTVFLRCENFKCRDNALFSNIKLMVLVIHCEKIRAFVQGI
QHGKKLCSFTLAQNKDEILQSAPMYQYLDRKMFKEAYQIACLGVTDTDWRELAMEALEGL
EFETAKKAFTRVQDLRYLELINSIEERKKRGETNNDLFLADVFSYQGKFHEAAKLYKRSG
HENLALDMYTDLRMFEYAKDFLGSGDPKETKMLITKQADWARNINEPKAAVEMYISAGEH
IKAIEISGDHGWVDTLIDIARKLDKAEREPLLMCAYYFKKLDNPGYAAETYLKIGDLKSL
VQLHVETQRWDEAFALGEKHPEFKDDIYVPYAQWLAENDRFEEAQKAFHKAGRQREAVRV
LEQLTHNAVVESRFNDAAYYYWMLSMQCLDIAQDPAQKDVMLDKFRHFQHLAELYHGYHA
IQRYTEEPFSFHLPETLFNISRFLLHSLTKDTPLGISKRRNTLFTLAKQSKALGAYKLAR
HAYDKLQGLQIPARFQKSIELGSLTIRSKPFHDSEELVPLCYRCSTNNPLLNNLGNVCIN
CRQPFVFSASSYEVLHLVEFYLEEGITDEEAVSLIDLEAPRHKRENKWQEITSNNSQTLR
LDETMDSMGDDDPFTAKLSFEQGGSEFVPVVVNRSVLRSMSRRDVLIKRWPPPLQWQYFR
SLLPDASITMCPSCFQMFHSEDYELLVLQHTCCPYCRRRIDDSSS
Download sequence
Identical sequences M3Z0H7
ENSMPUP00000017089 ENSMPUP00000017089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]