SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017090 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017090
Domain Number 1 Region: 1548-1659
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.06e-24
Family Synaptotagmin-like (S variant) 0.0083
Further Details:      
 
Domain Number 2 Region: 1137-1268
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.36e-23
Family Synaptotagmin-like (S variant) 0.016
Further Details:      
 
Domain Number 3 Region: 2-121
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.41e-22
Family Synaptotagmin-like (S variant) 0.081
Further Details:      
 
Domain Number 4 Region: 340-468
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.55e-21
Family Synaptotagmin-like (S variant) 0.019
Further Details:      
 
Domain Number 5 Region: 193-328
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.84e-19
Family Synaptotagmin-like (S variant) 0.038
Further Details:      
 
Domain Number 6 Region: 1769-1925
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.87e-17
Family Synaptotagmin-like (S variant) 0.019
Further Details:      
 
Domain Number 7 Region: 1301-1406
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000268
Family Synaptotagmin-like (S variant) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017090   Gene: ENSMPUG00000017198   Transcript: ENSMPUT00000017344
Sequence length 2073
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896923.1:10447118:10616970:1 gene:ENSMPUG00000017198 transcript:ENSMPUT00000017344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRVIVESASNIPKTKFGKPDPIVSVIFKDEKKKTKKVDNELNPFWNEILEFDLRGVPLD
FSSSLTIVVKDFETIGQNKLIGTATVALKDLIGDQSRSLPYKLIPLLNEKGQDTGATIDL
VIGYDPPSAPHPNDPSGTSVSVTEGDEEEDGGDEDRLDGTVRGPGPRGTGGMASEAHLAR
RLTKGRKSRRILSSKPQDFQIRVRVIEGRQLSGNNIRPVVKVHVCGQTHRTRIKRGNNPF
YDELFFYNVHMTPSELMDEIISIRVYNSHSLRADCLMGEFKIDVGFIYDEPGHAVMRKWL
LLNDPEDSSSGAKGYMKVSMFILGTGDEPPSEKRERDNDSDDVESNLLLPAGVALRWVTF
LLKIYRAEDIPQMDDAFSQTVKEIFGGNADKKNLVDPFVEVSFAGKKVCTNIIEKNANPE
WNQVVNLQIKFPSVCEKIKLTIYDWDRLTKNDVVGTTYLHLSKIAASGGEVEDFSSSGSG
AASYTANTGETEVGFVPTFGPCYLNLYGSPREYTGFPDPYDELNNGKGEGVAYRGRILVE
LSTFLEKTPPDKKLEPISNDDLLVVEKYQRRRKYSLSAVFHSATMLQDVGEAIQFEVSIG
NYGNKFDTTCKPLASTTQYSRAVFDGNYYYYLPWAHTKPVVTLTSYWEDISHRLDAVNIL
LAMAEQLQLNLEALKAGMQGKVPANQLAEIWLKLIDEVIEDTRYTLPLLEGKANVTILDT
QIQKLRSRSLSQIHEAAVRMRSEATEVKSTLAEIEDWLEKLLQLTEEPQNSMPDVIIWMI
RGEKRLAYARIPAHQVLYSTSGETASGKYCGKTQTILLKYPQEKTHGPKVPVELRVNIWL
GLSAVEKKFNSFAEGTFTVFAEMYENQALMFGKWGTSGLVGRHKFSDVTGKIKLKREFFL
PPKGWEWEGDWIVDPERSLLTEADAGHTEFTDEVYQNESRYPGGEWKPAEDTYTDANGDK
AASPGELTCPPGWEWEDDAWVYDINRAVDEKGWEYGITIPPDNKPKSWVAAEKMYHTHRR
RRLVRKRKKDLTQSASSTARAMEEYEDREGWEYASLIGWKFHWKQRSSDTFRRRRWRRKM
APSETHGAAAIFKLEGALGADTTEDGDEKSTDKQKYSATAVFGANTPIVSCNFDRVYIYH
LRCYIYQARNLMALDKDSFSDPYAHVSFLHRSKTTEIIHSTLNPTWDQTIIFDEIEIYGE
PQTVLQNPPKVIIELFDNDQVGKDEFLGRSMCSPLVKLNSETDVTPKLLWHPVMNGDKAC
GDVLVTAELILRQKDGSNLPILPSQRAPNLYMVPQGIRPVVQLTAIEILAWGLRNMKNYQ
MASITSPSLIVECGGERVESVVIKNLKKTPNFPSSVLFMKVFLPKEELYMPPLVIKVIDH
RQFGRKPVVGQCTIDHLDRFRCDPYAGKEDLVPQLKGFVAVRLVKQRAASLLSAPPCRDV
VIEIEDTKPLLASKLTEKEEEIVDWWSKFYASTGEHEKCGQYIQKGYSKLKVYDCELEDV
TEFEGLTDFSDTFKLYRGKSDENEDPSVVGEFKGSFRIYPLSDDPSVPAPPRQFRELPDS
VPQECTVRIYIVRGLQLQPQDNNGLCDPYIKITLGKKVIEDRDHYIPNTLNPVFGRMYEL
CCYLPQEKDLKISVYDYDTFTRDEKVGETIIDLENRFLSRFGSHCGIPEQYCVSGVNTWR
DQLRPTQLLQNVARYKGFPPPILSEDGSRIRYGGRDYSLDEFEANKILHQHLGAPDERLA
LHILRTQGLVPEHVETRTLHSTFQPNISQGKLQMWVDVFPKSLGPPGPPFNITPRKAKKY
YLRVIIWNTKDVLLDEKSITGEEMSDIYVKGWIPGNEENKQKTDVHYRSLDGEGNFNWRF
VFPFDYLPAEQLCIVAKKEHFWSIDQTEFRVPPRLIIQIWDNDKFSLDDYLGFLELDLHR
TIIPAKSSEKCNLDMIPDLKAMNPLKAKTASLFEQKSMKGWWPCYADKDGSRVMAGKVEM
TLEILNEKEADERPAGKGRDEPNMNPKLDPPNRPETSFLWFTNPCKTMKFIVWRRFKWVI
IGLLILLILLLFVAVLLYSLPNYLSMKIVKPNA
Download sequence
Identical sequences M3Z0H8
ENSMPUP00000017090 ENSMPUP00000017090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]