SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017124 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017124
Domain Number 1 Region: 274-408,435-573
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.11e-67
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 5-257
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.81e-59
Family Ankyrin repeat 0.0000496
Further Details:      
 
Domain Number 3 Region: 583-728
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.29e-40
Family Ankyrin repeat 0.0001
Further Details:      
 
Domain Number 4 Region: 892-1095
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.06e-38
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0022
Further Details:      
 
Domain Number 5 Region: 813-874
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000373
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017124   Gene: ENSMPUG00000017232   Transcript: ENSMPUT00000017378
Sequence length 1105
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896923.1:11882119:11948057:-1 gene:ENSMPUG00000017232 transcript:ENSMPUT00000017378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVSSGFGRKDVVEYLLQNGANVQARDDGGLIPLHNACSFGHAEVVSLLLRHGADPNARD
NWNYTPLHEAAIKGKIDVCIVLLQHGAEPTIRNTDGRTALDLADPSAKAVLTGEYKKDEL
LESARSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAKD
KGDLVPLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGA
DPTLLNCHNKSAIDLAPTPQLKERLSYEFKGHSLLQAAREADVTRIKKHLSLEMVNFKHP
QTHETALHCAAASPYPKRKQICELLLRKGANINEKTKEFLTPLHVASEKAHNDVVEVVVK
HEAKVNALDNLGQTSLHRAAHCGHLQTCRLLLSYGCDPSIISLQGFTALQMGNENVQQLL
QEGIPLGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSV
VEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAA
KGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLARV
KKLSSPDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGADVNAQDKGGLIPLHNAAS
YGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQTP
LDLVSADDVSALLTAAMPPSALPSCYKPQVLNGMRSSGATGDSLSSGPSSPSSLSAASSL
DNLSGSFSELSSVVSSSGTEGASSLEKKDVPAVDFSITQFVRNLGLEHLMDIFEREQITL
DVLVEMGHKELKEIGINAYGHRHKLIKGVERLISGQQGLNPYLTLNTSGSGTILIDLSPD
DKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENH
NHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGC
PVHKDRSCYVCHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVI
YRGEQAYPEYLITYQIMRPEGMVDG
Download sequence
Identical sequences M3Z0L2
ENSMPUP00000017124 ENSMPUP00000017124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]