SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017141 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017141
Domain Number 1 Region: 216-230,356-617
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-63
Family Nuclear receptor ligand-binding domain 0.0000672
Further Details:      
 
Domain Number 2 Region: 147-229
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.66e-32
Family Nuclear receptor 0.0000738
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017141   Gene: ENSMPUG00000017249   Transcript: ENSMPUT00000017395
Sequence length 629
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896899.1:36126759:36206885:-1 gene:ENSMPUG00000017249 transcript:ENSMPUT00000017395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATNMEGLVQHRVGTQQVAEVPRTQTSRPESPGMTSPSPRIQIISTDSAVASPQRIQIVT
DQQTGQKIQIVTAVDASGSPKQQFILTSPDGAGTGKVILASPETSSAKQLIFTTSDNLVP
GRIQIVTDSASVERLLGKADVQRPQVVEYCVVCGDKASGRHYGAVSCEGCKGFFKRSVRK
NLTYSCRSNQDCIINKHHRNRCQFCRLKKCLEMGMKMESVQSERKPFDVQREKPSNCAAS
TEKIYIRKDLRSPLIATPTFVADKDGARQTGLLDPGMLVNIQQPLIREDGTVLLATDSKA
ETSQGALGTLANVVTSLANLSESLNNGDASEMQPEDQSASEITRAFDTLAKALNTTDSSS
PPSLADGIDASGGGGIHVISRDQSTPIIEVEGPLLSDTHVTFKLTMPSPMPEYLNVHYIC
ESASRLLFLSMHWARSIPAFQALGQDCNTSLVRACWNELFTLGLAQCAQVMSLSTILAAI
VNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNSMAKLDIDGYEYAYLKAIVLFSPDHPG
LTSTSQIEKFQEKAQMELQDYVQKTYSEDTYRLARILVRLPALRLMSSNITEELFFTGLI
GNVSIDSIIPYILKMETAEYNGQITGASL
Download sequence
Identical sequences E2RI85 M3Z0M9
ENSMPUP00000017141 XP_004738645.1.14098 XP_005632175.1.84170 XP_005632176.1.84170 XP_005632178.1.84170 ENSMPUP00000017141 ENSCAFP00000006818 ENSCAFP00000006818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]