SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017163 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017163
Domain Number 1 Region: 233-348
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000374
Family Synaptotagmin-like (S variant) 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000017163
Domain Number - Region: 653-727
Classification Level Classification E-value
Superfamily BLRF2-like 0.0889
Family BLRF2-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017163   Gene: ENSMPUG00000017272   Transcript: ENSMPUT00000017418
Sequence length 954
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896963.1:5537192:5639743:1 gene:ENSMPUG00000017272 transcript:ENSMPUT00000017418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFRGPEPWVPASLQSQRLKAEEKILDLEFEVLSVGFNEEGRYALRLTAENPLQAGSGAG
VQLQVNDGDPLPTCSVVTDIIEQQDPGQSLTLTRNKFVFTLPKGFCKNDWQHDAHLRVEA
LRLGGVSGRPAQKVGEAIFPVFPRPDQPRMNLWAREHEDLYCYRGSLALLRASADTTARH
CGGLAYSVAFREHQGPQPPAPNCPKRRGRPEVAESPEEPLNTGQSVESVTSHLSPSNKET
IVVTLHGATNLPTCKDGSEPWPYVMVKTTSEDMKNQNAKAVTSVTSKPTTAPIWGDTVKV
ELQAEDAGREDVILKVMDNKNKEELLSYQIPIKYLRVFHPYHFELVKPAQSGKAEGAADK
THLYTTIVRKGSFFPRYIGNNHTALEVFLRGVNEPLVNNPHPMVVIARVVPNYSDFKVHQ
VKQDPAFVGLPITRLSFPVSSVMYFDVPRVSQNGCPQLSKPAGPPELPLWNQSFLFQGRD
GATNFSEDTALVLEYYSSASMKGSEPWTLSKPLGVSVLPLKSRLYRKMLAGKGVNGLRVE
KLPITDTKLKTINGEAPTVDISFQLLSSEKPEDFLTPNSSQVLPILDPKILDEKLGTIRE
SWSKSTVSSSMDSNPSTSQETEIEPQVPKMSHEMELNNYRRAMQKMAEDILSLRKHASML
EAENRMLRSQLTQEGGEEEPDNGNKAQKLVSMKQKLLLSELELKKLRDRVQHLQNELIRK
NDREKELLLLHQAQQPQAVLLKRYQDKLQKMKALEETVRHQEKVIEKMERVLEDQLRDRK
EPLLNRLPGKPTMAFPALSASGLPPGPTGENLPVHLYSVLLAENARLRAELEKNRHQSAP
IILQQQALPDLLASTSDKFNLLAKLERAQSRILSLESQLEDSARRWGREKQDLAIRLQEQ
EYGLNSVITDLPNSLAHDKDHRRPSKLDPLMPSLETKLNKPSNSEKTSAASYQT
Download sequence
Identical sequences M3Z0Q1
ENSMPUP00000017163 ENSMPUP00000017163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]