SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017172 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017172
Domain Number 1 Region: 49-481
Classification Level Classification E-value
Superfamily Ras GEF 1.57e-104
Family Ras GEF 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017172   Gene: ENSMPUG00000017281   Transcript: ENSMPUT00000017427
Sequence length 546
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896923.1:14251808:14306672:-1 gene:ENSMPUG00000017281 transcript:ENSMPUT00000017427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLEPQETMPQTSVVFSSILGPSCSGQVQPGMGERGSGAGSSGDLVFQEGRLISGSLEAL
MEHLVPTVDYYPDRTYIFTFLLSSRVFIPPHDLLARVGQICLEQRQQLETGSEKAKLKSF
SAKIVQLLKEWTEAFPYDFQDEKAMAELKAITHRVTQCDEENGTVKKAIAQMTQSLLLSL
AARNQLQELREKLRSPAMDKGSVLKAKPPATQKDILGVCCDPLVLAQQLTHIELERVSSI
HPEDLMQIVSHMDSRDKHRCRGDLTKTYSLEAYDNWFNCLSMLVATEVCRVVKKKHRTRM
LEFFIDVARECFNIGNFNSMMAIISGMNLSPVARLKKTWSKVKTAKFDVLEHHMDPSSNF
CNYRTALQGATQRSQMANSSREKIVIPVFNLFVKDIYFLHKIHTNHLPNGHVNFKKFWEI
SRQIHEFMTWTQVECPFEKDKKIQNYLLTAPIYSEEALFIASFESEGPENHMEKDSWKTL
RPAFPGASERPRSWLWTGCTYGTAQESTHQHSVSHARGGKGQELESESQSGHHGRLLGVE
ITESEG
Download sequence
Identical sequences M3Z0R0
ENSMPUP00000017172 ENSMPUP00000017172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]