SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017189 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000017189
Domain Number - Region: 417-510,551-585
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000114
Family PLC-like (P variant) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017189   Gene: ENSMPUG00000017299   Transcript: ENSMPUT00000017445
Sequence length 1092
Comment pep:novel scaffold:MusPutFur1.0:GL896899.1:38202862:38269236:-1 gene:ENSMPUG00000017299 transcript:ENSMPUT00000017445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLNAWEREDEDPVSMGPLSSMASFYQSGSECDVEEYLKVKAQAQESDSEHPCSSESSFG
LASTLDSDVPQAVPCKFIISLAFPVSTGYKGKYTGLMEKHKKHPKMDKPAAKFRRYYHIE
YFLLPDDAEPRKVDMVLFPLVAKVFLDSGVKTVRPWHEGDKVWVSWTQTFNISVTKELLK
KINFHKITLKVWDAKDKVSRKVRYYRLKNTGYSEDTGTFEEVKSLVLNQRRLSAQAPHIK
EEWNQEDARDKAEKAGKHIKSLREFETFPKIPEGDEKVLRMEELSTVRWSISRETALSLG
TAVGMEMEGEDHHERSSFDSLTNMLEKQKFQIKRKDSEGRKKSQKRGKKSQTEEETDLKM
EGDWKHSTFSTELAVMPLLAGWQTIVSRGRGKSASILDCFLTLKTEGPIMTEEQKQDLNP
LTIKIKCVSCLPSQPVPFHELEKLCIPVYCKYQFFKTPVHRTEGRPHGIHIHFQDINVIF
LGAMQPSDLREYLEGPPMVVQVHDRDRKLEEYSRKPTLFGDDPLDAYLNLQSLISLEETE
NNPFESQNKIWDPYGVAQVSFADLLLGQKYLNLVVPIHSCEPKPKHCGQDGKSRKVVGFR
VPTDGFQHNPMPMGNYLEANSLLKMRVDIAVPLQARAEAPDPELSGTQFGRIIFVFDSKK
ISLLYGLLQDITMINAKALDLDAHPIRNIQQILSAFKMRVKIQERQDLDVLTGFHLLDGK
LHLLILEGLADQGLKQLWDSHQSRITRAEPGKHKVLYNSALRFRHRLYADLETVLYQVHL
FKPLSQLMKHSALYVRNSVLQKAFQALTRIYSICHHSTKLREVITRGLLPSSTMVKDLSQ
ELGLPISQDDLADGKLMVFPSQPAPCPERFLSQKSTLAYEIQAHRDKYLRWRNTMVLKSK
GQEPSLIQKNITGAYQLKKPSKSVVKVIRISAPAKDAVYNYSIQTLNSTELAKKELYREM
AKEPKKRFTYSQKYLSAMVEPQDSEEEEKNAKKRSRQAWLTANGFQLTGLHRSPESDCHL
RLPPVGTVPELKEEWRENAGFATMLDRERWGWDRRHQDFDLYRQPPPFLELPPPPVPRPA
TGRKTKASSPVS
Download sequence
Identical sequences M3Z0S7
ENSMPUP00000017189 ENSMPUP00000017189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]