SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017215 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017215
Domain Number 1 Region: 213-341
Classification Level Classification E-value
Superfamily PX domain 1.05e-25
Family PX domain 0.0018
Further Details:      
 
Domain Number 2 Region: 5-70
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000131
Family SH3-domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000017215
Domain Number - Region: 364-571
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00167
Family BAR domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017215   Gene: ENSMPUG00000017325   Transcript: ENSMPUT00000017471
Sequence length 573
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896963.1:6646412:6653825:1 gene:ENSMPUG00000017325 transcript:ENSMPUT00000017471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKGRALYDFRSENKEEISIHQDEDLVIFSETSLDGWLQGQNSRGETGLFPASYVEIIR
SGASPNHADYSSSPGSLGTQVSLYDSSGVASPSRSGGVSGFLSHQGSFEEDDDDDWDDWD
DGSTVVEEPRAGGLGTNGHPPLNLSYPGAYPSQHMAFRPKPALERQDSLASAKRGSVVGR
NLNRFSCFVRSGVEAFILGDVPMMAKIAETYSIEMGPRGPQWKANPHPFACSVEDPTKQT
KFKGIKSYISYKLTPTHAGSPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEED
FIEKRKRRLILWMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRAEKDEMVGASFLLT
FQIPTEHQDLQDVEDRVDTFKAFSKKMDDSVLQLSTVASELVRKHVGGFRKEFQKLGSAF
QAISHAFQMDPPFSSEALNSAISHTGRTYEAVGEMFAEQPKNDLFQMLDTLSLYQGLLSN
FPDIIHLQKGAFAKVKESQRMSDEGRMAQDEADGIRRRCRVVGFALQAEMNHFHQRRELD
FKHMMQNYLRQQILFYQRVGQQLEKTLRMYDSL
Download sequence
Identical sequences M3Z0V3
XP_004758525.1.14098 ENSMPUP00000017215 ENSMPUP00000017215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]