SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017273 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017273
Domain Number 1 Region: 718-1098
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.48e-117
Family Ankyrin repeat 0.00000237
Further Details:      
 
Domain Number 2 Region: 494-748
Classification Level Classification E-value
Superfamily Ankyrin repeat 4e-68
Family Ankyrin repeat 0.0000501
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000017273
Domain Number - Region: 61-135,167-316
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00299
Family Nucleotide and nucleoside kinases 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017273   Gene: ENSMPUG00000017383   Transcript: ENSMPUT00000017529
Sequence length 1429
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896919.1:10495220:10529255:1 gene:ENSMPUG00000017383 transcript:ENSMPUT00000017529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNPWEEKVCKMAQTSLLQGKQFYCREWVFHKLQHCLQEKTNCCNSAVNTPSLVMNSGNN
ASVVSGKGAAWGVLLVGGPGSGKTALCTELLWPSSPASLQRGLHRQALAFHFCKAQDSDT
LCVGGFIRGLVAQICRSGLLQGYEDKLRDPAVQSLLQPGECERNPAEAFKRCVLLPLLGM
KPPQQSLYLLVDSVDEGCNITEGEQTSTSLSGTVAELLAGHHEFFPPWLLLLCSARKQSK
AVTKMFTGFRKISLDDLRKAYIVKDVQQYILHRLDQEEALRQHLTKETAEMLNQLHIKSS
GCFLYLERVLDGVVENFIMLREIRDIPGTLNGLYLWLCQRLFVRKQFAKVQPILNVILAA
CRPLTITELYHAVWTKNMSLTLEDFQRKLDVLSKLLVDGLGNTKILFHYSFAEWLLDVKH
CTQKYLCNAAEGHRMLAMSYTCQAKNLTPLEAQEFALHLINSNLQLETAELALWMIWNGT
PVRDSLSTLIPKEQEVLQLLVKAGAHVNSEDDRTSCIVRQALEREDSIRTLLDNGASVNQ
CDSNGRTLLANAAYSGNLDVVNLLVSRGADLEIEDAHGHTPLTLAARQGHTKVVNCLIGC
GANINHTDQDGWTALRSAAWGGHTEVVSALLYAGVKVDCADADSRTALRAAAWGGHEDIV
LNLLQHGAEVNKADNEGRTALIAAAYMGHREIVEHLLDHGAEVNHEDVDGRTALSVAALC
VPASKGHASVVSLLIDRGAEVDHCDKDGMTPLLVAAYEGHVDVVDLLLEGGADVDHTDNN
GRTPLLAAASMGHASVVNTLLFWGAAVDSIDSEGRTVLSIASAQGNVEVVRTLLDRGLDE
NHRDDAGWTPLHMAAFEGHRLICEALIEQGARTNEIDNDGRIPFILASQEGHYDCVQILL
ENKSNIDQRGYDGRNALRVAALEGHRDIVELLFSHGADVNYKDADGRPTLYILALENQLT
MAEYFLENGANVEASDAEGRTALHVSCWQGHLEMVQVLITYHADVNAADNEKRSALQSAA
WQGHVKVVQLLIEHGAIVDHTCNQGATALCIAAQEGHIDVVQVLLEHGADPNHADQFGRT
AMRVAAKNGHSQIIKLLEKYGASSLNGCSPSPVHTMEQKPLQSVSSKMQSLTIKSNSSGS
TGGGDMQPSLRGLPNGPAHAFSSPSESPDSTVDRQKSSLSNNSLKSSKNSSLRTTSSTAT
AQTVPIDSFHNLSFTEQIQQHSLPRSRSRQSIVSPSSTTQSLGQSHNSPSSEFEWSQVKP
SLKSTKTNKGGKSENSSKSGAAGKKAKQNNSSQPKVLEYEMTQFDKRGPTAKSGTSVPPK
QMPAESQCKIMVPSTQQEIGRSQQQFLIHQQSGEQKKRNGIMTNPNYHLQSNQVFLGRVS
VPRTIQDRGHQEVLEGYPSSETELSLKQALKLQIEGSDPTFNYKKETPL
Download sequence
Identical sequences M3Z111
XP_004748006.1.14098 XP_004748007.1.14098 XP_012909368.1.14098 ENSMPUP00000017273 ENSMPUP00000017273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]