SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017305 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017305
Domain Number 1 Region: 526-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.16e-21
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 2 Region: 469-526
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.33e-18
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 356-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000592
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 4 Region: 413-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000645
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 5 Region: 567-620
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000101
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 6 Region: 319-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000139
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 167-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000153
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 8 Region: 242-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000227
Family Classic zinc finger, C2H2 0.036
Further Details:      
 
Domain Number 9 Region: 4-128
Classification Level Classification E-value
Superfamily SET domain 0.0000139
Family Histone lysine methyltransferases 0.06
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000017305
Domain Number - Region: 296-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0389
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017305   Gene: ENSMPUG00000017415   Transcript: ENSMPUT00000017561
Sequence length 630
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896919.1:13967108:14186203:1 gene:ENSMPUG00000017415 transcript:ENSMPUT00000017561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGMYVPDRFSLKSSRVQDGMGLYTARRVRKGEKFGPFAGEKRMPEDLDENMDYRLMWEV
RGSKGEVLYILDATNPRHSNWLRFVHEAPSQEQKNLAAIQEGENIFYLAIEDIETDTELL
IGYLDSDMEADEEEQQIMTMIKEGEVKNSKGQSTAGRKDCLGRKEDYACPQCDSSFTSEE
ILAEHLQTLHQKPTEEKEFKCKNCGKKFPVKQALQRHVLQCPARSSLKDSSRSFQCSVCS
SSFSSASSFEQHQETCRGDARFVCKADSCGKRLKSRDALRRHQENVHAGDPKKKLICSVC
NKKCSSASSLQEHRKIHEVFDCQECMKKFISANQLKRHMITHSEKRPYNCEICNKSFKRL
DQVGAHKVIHSEDKPYKCKLCGKGFAHRNVYKNHKKTHSEERPFQCEECKALFRTPFSLQ
RHLLIHNSERTFKCHHCDATFKRKDTLNVHVQVVHERHKKYRCELCNKAFVTPSVLRSHK
KTHTGEKEKICPYCGQKFASSGTLRVHIRSHTGERPYQCPYCEKGFSKNDGLKMHIRTHT
REKPYKCSECSKAFSQKRGLDEHKRTHTGEKPFQCDVCDLAFSLKKMLIRHKMTHNPNRP
LAECQFCHKKFTRNDYLKVHMDNIHGEVDS
Download sequence
Identical sequences M3Z143
ENSMPUP00000017305 ENSMPUP00000017305 XP_004748046.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]