SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017310 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017310
Domain Number 1 Region: 526-847
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.95e-109
Family PDEase 0.0000000000131
Further Details:      
 
Domain Number 2 Region: 137-331
Classification Level Classification E-value
Superfamily GAF domain-like 1.7e-44
Family GAF domain 0.00008
Further Details:      
 
Domain Number 3 Region: 317-521
Classification Level Classification E-value
Superfamily GAF domain-like 2.12e-37
Family GAF domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017310   Gene: ENSMPUG00000017420   Transcript: ENSMPUT00000017566
Sequence length 865
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896919.1:15004118:15153608:1 gene:ENSMPUG00000017420 transcript:ENSMPUT00000017566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERASPGSGGSQLQRDQDCVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVHTIPVCKE
GIRSHTESCSCLSQPSPRADSSAPGTPTRKISASEFDRPLRPIVVKDSEGTVSFLADSEK
KEQMPLTPRRFDNDEGDQCSRLLELVKDISSHLDVTALCHKIFLHIHGLISADRYSLFLV
CEDSSNDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAAFGEPLNIKDAYEDPR
FNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFC
GIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIF
IVDEDCSDSFSSVFHMECEELEKSSDTLTRERDANRINYMYAQYVKNTMEPLNIPDVSKD
KRFPWTNENTGNINQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEENTGKVKPFNRNDEQ
FLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETRELQSLAAAVVPS
AQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCRWILSVKKNYRKNV
AYHNWRHAFNTAQCMFAALKAGKIQSKLTDLEILALLIAALSHDLDHRGVNNSYIQRSEH
PLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKMIKQAILATDLALYIK
RRGEFFELIRKNQFNLEDPHQKELFLAMLMTACDLSAITKPWPIQQRIAELVATEFFDQG
DRERKELNIEPADLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCFPLLDGCRKNR
QKWQALAEQQEKMLINGESSQAKRN
Download sequence
Identical sequences M3Z148
ENSMPUP00000017310 XP_004748049.1.14098 ENSMPUP00000017310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]