SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017321 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017321
Domain Number 1 Region: 9-87
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-16
Family PDZ domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017321   Gene: ENSMPUG00000017431   Transcript: ENSMPUT00000017577
Sequence length 1263
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896919.1:15387967:15565343:-1 gene:ENSMPUG00000017431 transcript:ENSMPUT00000017577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTGDFICISMTGGAPWGFRLQGGKEQKQPLQVAKIRSQSKASGSGLCEGDEVVSINGNP
CADLTYPQVIKLMESIRDSLQMLIKRPSSGVNESSISETENKTPEHLTHEGPVESTILQI
QPATKNQNRELYVASVRSGAPLAGDQGSGPGFSGSIQEETGLSYHVAPHMPDSQTGHLAE
EIILREKPEVGQPGPVVELQLSLSQERHKVTNVPVVALLGAEKSKSPDPDPHVQHCGIVH
INSVPTREKGEPSLRSSKIIQLSSGKELKVTRGCEAGDVGLPQVEVILDCLDRQKTEGCR
LQAGKGCVDSPVEGGQSEAPPSLVSFAVSSEGTEQGEDPRSERDHSRPHKHRARHARLRR
SESLSEKQVKEAKSKCKSIALLLTDAPNPNSKGVLMFKKRRRRAKKYTLVSYGTGELERE
ADEEEEGDREDTCEVAFLGTSESEVDEELSSDVDDSAQVVNFDWDSGLVDIEKKLNRGDK
MEMLPDTSGKGALMFAKRRERMDQIAAQKEEERVGGMPGREPEAAQTDGLRTVASYQRKE
EESVRTQSSVSRSYIEVSHGHGHVPQQNGFSGACETADAPRMIPMNRTAKPFPGSANQLA
TPFSPTRNVASPMADFPAPPPYSAVTPPPEAFSRAMSSPPAGPAQPPPWPQPAPWAQPAF
YDASERIASRDERIAVPAKRTGILQEAKRRSTTKPMFTFKEPKVSPNPELLSLLQNSEGK
KGTGAGGDSGPEEDYLSLGAEACNFMQSSSAKHKTPPPVAPKPAVKSSPSQPVTPVSPVW
SPGAAPTQPPAFPASSPSQGTVVSSIKIAQPSYAPARPASALTLAGPFRGPQAAVASPNY
TPKPAAPTPPVNAAHAAAAGPSNELPGMSGKGAQLFAKRQSRMEKYVVDSDTVQAHAARA
QSPTPSLPAGWKYSSNVRAPPPVAYNPIHSPSYPLAALKSQPSAPQASKTSKKKGKKPLN
ALDVMKHQPYQLNASLFTFQPPDAKDGLPQKSSAKVSPVPGMKQALPPRPVNPGSPTTAQ
ASSVYSAPAYSSQPAFFAEAASPISASPVPVGIPASPKQESASASYFVAPRPKFSAKKSG
VPVQIGHSLSLPGRPAPPTISTTSPWVFQPAYNYSSKPSDELEKANKRLTPWEAATKSPL
GLVDDAFKPRNIQESIVANVVSAARRKVLPGCSEDWNERVSYVPQAQKANVSSFARQEYN
VASLPNNNMSTNSQYGSQLPYAYYRQPSRNDSEIMSMETRSDYCLSTADYNYNPHPRGWR
RQT
Download sequence
Identical sequences M3Z159
ENSMPUP00000017321 XP_004748057.1.14098 ENSMPUP00000017321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]