SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017359 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017359
Domain Number 1 Region: 102-144
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.33e-16
Family LIM domain 0.0024
Further Details:      
 
Domain Number 2 Region: 37-83
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.83e-16
Family LIM domain 0.00038
Further Details:      
 
Domain Number 3 Region: 145-190
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000124
Family LIM domain 0.00037
Further Details:      
 
Domain Number 4 Region: 8-35
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000205
Family LIM domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017359   Gene: ENSMPUG00000017469   Transcript: ENSMPUT00000017615
Sequence length 193
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896932.1:3269957:3277777:1 gene:ENSMPUG00000017469 transcript:ENSMPUT00000017615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKS
CYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESAQPHRPTTNPNTSKFAQKYGGAEKCS
RCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGF
GYGQGAGALVHAQ
Download sequence
Identical sequences D2HF33 G3V9V9 M3Z197 P97314
ENSMUSP00000020403 10090.ENSMUSP00000020403 10116.ENSRNOP00000061356 ENSMUSP00000129498 NP_031818.3.92730 NP_803174.2.100692 NP_803174.2.4139 XP_002920690.1.58354 XP_004404891.1.74151 XP_004752420.1.14098 XP_004752421.1.14098 XP_006737824.1.47382 XP_008682551.1.72690 XP_008682552.1.72690 XP_008850213.1.79516 XP_008850221.1.79516 XP_008850230.1.79516 XP_017658496.1.79516 XP_021514680.1.76796 XP_021534231.1.83697 ENSMUSP00000020403 ENSAMEP00000006991 ENSMPUP00000017359 ENSAMEP00000006991 ENSMPUP00000017359 ENSRNOP00000005041 ENSRNOP00000061356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]