SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017385 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017385
Domain Number 1 Region: 201-406
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.000000000000273
Family DNA-binding domain from NDT80 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017385   Gene: ENSMPUG00000017495   Transcript: ENSMPUT00000017641
Sequence length 912
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896932.1:8902824:9023477:-1 gene:ENSMPUG00000017495 transcript:ENSMPUT00000017641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVLGEKEALQQFFEAQGPSDTLENPVLDTSLLEEFLGNDFYLGILQQQLPDTPPYSASD
SCSPPQMQGACCPAMRPEAAVGRPPATSLHSAAAAGMLPAHLPQSSCEMSSSAHSLGSSR
HCYPNTSHLPTPPDRCMSSHPEISRPYHQQPLCHSPGASLPPTKKRKCTQALEDSGDCHV
WAHHSRPMTSRSSSSEVLFYDSEGQNMTPVDQGSPSLKWQPYQSVPWHSLFTGHYEKLPD
IGYRVVTDKGFNFSPADEAFVCQKKNHFQITIHIQVWGSPKFVKTQMGLKPIEMFYLKAF
GVKVEATNQIIAIEQSQADRSKKIFNPVKIDLPADQVTKVTLGRLHFSETTANNMRKKGK
PNPDQRYFMLVVGLYAVHQDQFYLLSAHISERIIVRASNPGQFENDSDVLWQRGQVPESV
ICHSRVGINTDAPDEALVVCGNMKVMGTIMHPSDSRAKQNIQEVDTNEQLRRIAQMRVVE
YDYRPEFASSMGINAAHQTGMIAQEVREILPRAVREVGDVTCENGETLRNFLMVDKDQIF
MENVGAVKQLCKLTHNLEERIEELEIWNRKLARLKRLSSCKSSASEASSISKFSRALSAS
SPRRSIPKKTNKVYFSGKKQLCPNWVFQTLVIILIAVMAFCALTIVSLYILSLKDQNQRA
PNLPLSNITSSQEPALLPTASPSAPNTSLATTQSSFPVPEITFCEILPCQETYCCPIWGK
RGVPSGPVRRLSQEEETHQRPWAEDRSLSFLARDALTSPDWGSDWIDTTISSIQIMEIQQ
VIDHRYCGRGLQCSAGNYNYNIPVNKHTPTNVKFSLEINTTEPLIVFQCKFTLGNICFHG
TRGAKRTQSRQEVSQEMTQGYQHIWTLPVAPFFDSTYHFRVAAPDLADCSTDPYFAGIFF
TDYFFYFYRHCV
Download sequence
Identical sequences M3Z1C3
ENSMPUP00000017385 ENSMPUP00000017385 XP_004752581.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]