SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017389 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017389
Domain Number 1 Region: 18-143
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-40
Family Phosphotyrosine-binding domain (PTB) 0.000000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017389   Gene: ENSMPUG00000017499   Transcript: ENSMPUT00000017645
Sequence length 517
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896932.1:9207223:9219865:-1 gene:ENSMPUG00000017499 transcript:ENSMPUT00000017645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTWSSEEAMGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRK
RDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSIN
VVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVG
SARLPSVGEESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARISNAESNTPKEE
PSRVEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQLGRDQVSGSGANSTEWDTGYD
SDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSSSTSDTQNINNSAQRRTALLNYEN
LPSLPPVWEARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSR
RRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNPQTPKTPTTPLPQTPTRRTELY
AVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPM
Download sequence
Identical sequences M3Z1C7
ENSMPUP00000017389 ENSMPUP00000017389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]