SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017391 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017391
Domain Number 1 Region: 39-167
Classification Level Classification E-value
Superfamily Lysozyme-like 9.38e-55
Family C-type lysozyme 0.000000803
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017391   Gene: ENSMPUG00000017501   Transcript: ENSMPUT00000017647
Sequence length 168
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896932.1:9423020:9430704:-1 gene:ENSMPUG00000017501 transcript:ENSMPUT00000017647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNTEDCSPWSARRSGFPVNMKALLLLGILFLSVTVQGKVFERCELARTLKRLGLGGYRG
VSLANWMCLAKWESNYNTKATNYNPGSRSTDYGIFQINSRYWCNDGKTPGAVNACGIPCS
DLLKDDITQAVACAKRVVRDPNGIRAWVAWKAHCENRDVSQYVRNCGV
Download sequence
Identical sequences M3Z1C9
ENSMPUP00000017391 ENSMPUP00000017391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]