SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017393 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017393
Domain Number 1 Region: 15-313
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.86e-79
Family Pancreatic carboxypeptidases 0.000000001
Further Details:      
 
Domain Number 2 Region: 314-409
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 3.34e-23
Family Carboxypeptidase regulatory domain 0.00000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017393   Gene: ENSMPUG00000017504   Transcript: ENSMPUT00000017650
Sequence length 443
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896932.1:9715669:9815962:1 gene:ENSMPUG00000017504 transcript:ENSMPUT00000017650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFVRLWLGLLLPLGGALDFGYHHQEEMEAFLKNVARNYSSITRLHSVGKSVKGRNLWVL
VVGRFPKEHRIGIPEFKYVANMHGDETVGRELLLHLIEHLVTHDGKDLEITNLINSTRIH
FMPSMNPDGFEAVIKPDCFYSNGRENTNFYDLNRNFPDAFEFNNVSRQPETVAVMEWLKT
ETFVLSANLHGGALVASYPFDNGVPATGTSHSRSLTPDDDVFQYLAYTYASRNPTMKKGD
QCKNKMNFPSGITNGYSWYPLKGGMQDYNYIWAQCFEITLELSCCKYPHEEKLPFFWNKN
KASLIEYIKQVHLGVKGQVFDQNGNPLPNVIVEVQDRKHICPYRTNKFGEYYLLLLPGSY
VINVTVPGHNPYLTKVVIPEKSQNFSALKKDILLPFRRQLDSIPVSNPSCPKIPLYSDLP
SHSAATKPGLFFFLVTVFHMFVK
Download sequence
Identical sequences M3Z1D1
ENSMPUP00000017393 ENSMPUP00000017393 XP_004752512.1.14098 XP_012911528.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]