SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017404 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017404
Domain Number 1 Region: 179-281
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-25
Family PDZ domain 0.029
Further Details:      
 
Domain Number 2 Region: 713-798
Classification Level Classification E-value
Superfamily PDZ domain-like 6.57e-21
Family PDZ domain 0.0000184
Further Details:      
 
Domain Number 3 Region: 501-601
Classification Level Classification E-value
Superfamily PDZ domain-like 6.97e-21
Family PDZ domain 0.00000658
Further Details:      
 
Domain Number 4 Region: 607-701
Classification Level Classification E-value
Superfamily PDZ domain-like 7.23e-20
Family PDZ domain 0.00000777
Further Details:      
 
Domain Number 5 Region: 82-182
Classification Level Classification E-value
Superfamily PDZ domain-like 8.28e-20
Family PDZ domain 0.01
Further Details:      
 
Domain Number 6 Region: 281-385
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-19
Family PDZ domain 0.0000921
Further Details:      
 
Domain Number 7 Region: 1020-1117
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-17
Family PDZ domain 0.00000894
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017404   Gene: ENSMPUG00000017516   Transcript: ENSMPUT00000017662
Sequence length 1156
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896932.1:11872357:12054427:1 gene:ENSMPUG00000017516 transcript:ENSMPUT00000017662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRAFQMACPTTKSRLRLRSPNSFSYPYHITSLWQKDCNPLKGLHCVRNWMEINQTLHCT
FADESPYTKSASQTKPPDGALAVRRQSIPEEFKGSTVVELMKKEGTTLGLTVSGGVDKDG
KPRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYEL
PPVSVQGSSVIFRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGT
IKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDTVATASGPLLVEVA
KTPGASLGVALTTSMCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAE
ATQFLANTTDQVKLEILPHHQTRLALKGPDHVKIQRSDRQLAWDSWAGNHCSLHTYHHPH
TTHPDHCRVPALTGPKASPSNSPPALVSSFSPTSMSAYSLSSLNMGTLPRSLYSTSPRGT
MMRRRLKKKDFKSSLSLASSTVGLAGQVVHTETTEVVLTADPVTGFGIQLQGSVFATETL
SSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEI
EFDVAESVIPSSGTFHVKLPKKHSVELGITISSPSSRKPGDPLVISDIKKGSVAHRTGTL
ELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAIIYTVELK
RYGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAI
HLLQMAGETVTLKIKKQTDAQSASSPKKFPMASHLSDLGDVEEDPSPGQKPGKLSDTYPS
TVPSVDSAVDSWDSSGIDSSYGNQGSSFQASGYNFNTYEWRGPKQRGSLSPVTKPRSQTY
PDVGLNNEDWDRSTVSGFTGAPDSSEAEQEENFWSQALEDLETCGQSGILRELEATIMSG
STMSLNHEAPSPRSQLGRQASFQERSSSRPHYSQTTRSNTLPTDVGRKSVPLRKMKQEIK
EIMSPTPVELHKVTLYKSSDMEDFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLL
QVNHVRTRDFDCCLVVPLIAESGNKLDLVISRNPLASQKSIEQTLPGGEWSEQNSAFFQQ
PSHGGNLEIREPTNTL
Download sequence
Identical sequences M3Z1E2
ENSMPUP00000017404 ENSMPUP00000017404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]