SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017406 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017406
Domain Number 1 Region: 159-459
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.19e-58
Family Protein kinases, catalytic subunit 0.00058
Further Details:      
 
Domain Number 2 Region: 12-126
Classification Level Classification E-value
Superfamily DEATH domain 3.66e-30
Family DEATH domain, DD 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017406   Gene: ENSMPUG00000017518   Transcript: ENSMPUT00000017664
Sequence length 628
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896932.1:12128071:12177188:-1 gene:ENSMPUG00000017518 transcript:ENSMPUT00000017664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWTAAAAAARSCGARGALTAHTLLFDLPPTLLGELCAVLDSCDGALGWRGLAERLSNSW
LDVRHIEKYVDQGKSGTRELLWSWAQKNKTIGDLLEILQEMGHHRAIHLIVNHGASVNPS
EQRHQGDGFPNMLPKETAHVTVDNVSIPERNEKGILFKSSISFQDISDGTKNFHKDFLIG
EGEIFEVYRAEIQNQTYAIKLFKQEKKMQCKKQWKRFLSELEVLLLFHHPNILELAAYFT
ESEKFCLVYPYMRNGSLFDRLQCVGNTAPLPWHIRISVLIGTSKAIQYLHNTEPCLVICG
RVSSANILLDDQFQPKLTDFGMAHFRPHLEHQSSTISMTSSSSKHLWYMPEEYIRQGKLS
IKTDVYSFGIVIMEVLTGCKVVLDDPKHIQLRDLLMELMEKRGLDSCLSFLDKKVHPCPR
NFSAKLFSLAGQCAISRAKLRPSMDEVLTTLESAQASLYFAEDPPTSLKSFRCPSPLFLE
NVPSIPVEDDENQNNHSLPHDKGLSNHSLPHDKGLRKDGVTRRVPFECSQSEVTFLGLDR
TTGSKRNEDAYNRPSSSCPESWSPEHAAVSQDPRTYVTDMEPSAEAPGHSYRSRPVETSS
SCEFSWNECEPCKKESISPEDKEGSKYC
Download sequence
Identical sequences M3Z1E4
ENSMPUP00000017406 XP_012911536.1.14098 ENSMPUP00000017406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]