SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017433 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017433
Domain Number 1 Region: 395-571
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.04e-75
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000116
Further Details:      
 
Domain Number 2 Region: 573-673
Classification Level Classification E-value
Superfamily E set domains 4.51e-31
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017433   Gene: ENSMPUG00000017545   Transcript: ENSMPUT00000017691
Sequence length 912
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896916.1:915331:1055455:1 gene:ENSMPUG00000017545 transcript:ENSMPUT00000017691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAPEQQPDPDGGDAPGHEPGGSPQDEFDFSILFDYEYLNPIEEEPNAHKVASPPSRLAY
PDEVLDYGLKPYSPLPSLPGEPPGGFGEPDRVGPQNFLSPAAKPAGASGLSPRIEITPSH
ELMQAGGPLRGRDTGLLGEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFI
SDTFSPYTSPCVSPNNGGPDDLCPQFQHIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVP
RPASRSSSPGAKRRHSCAGALVAPLPGASPQRSRSPSPQPRDDGAPAGYPPTAGSAVLMD
ALNSLAADSPCGIPPKMWKTSPDPSPVSAAAPPKAGLPRHIYPAVEFLGPCEQEEGRSAA
PESILLVPPTWPKQLVPAIPICSIPVTASLPPLEWPLSHQSGSYELRIEVQPKPHHRAHY
ETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTV
TTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRL
VFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDIDSCLVYGGQQMILTGQNFT
AESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRASVKVNFYVINGK
RKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPAHGGLGSQPYYPQHPVVAESPSCLVAT
MAPCQQFRSGLPSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSV
LVHAGSQGQSAPLLHTSPANQQASPVIHYSPTNQPLRCGNHQEFQHILYCENFAPGPTRP
GPPPASQGQRLSPGSYPTVIQQQSATSQRAAKNGPPVSDQKEVLPTGVTIKQEQNLDQTY
LDDGHRYSSCTF
Download sequence
Identical sequences M3Z1H1
ENSMPUP00000017433 XP_004746248.1.14098 ENSMPUP00000017433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]