SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017498 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017498
Domain Number 1 Region: 41-76
Classification Level Classification E-value
Superfamily WW domain 0.0000000415
Family WW domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000017498
Domain Number - Region: 305-349
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0011
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017498   Gene: ENSMPUG00000017611   Transcript: ENSMPUT00000017757
Sequence length 702
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896916.1:5335056:5344011:-1 gene:ENSMPUG00000017611 transcript:ENSMPUT00000017757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANENHGSPREEASLLSHSPGTSNQSQPCSPKPIRLVQDLPEELVHAGWEKCWSRRENRP
YYFNRFTNQSLWEMPVLGQHDVISDPLGLNATPLPQDSSLVETPPAENRPRKRQLSEEQP
SGNGVKKPKIEIPVTPTGPSVPSSPSIPGTPTLKMWGTSPEDKQQAALLRPTEVYWDLDI
QTNAVIKHRGPSEVLPPHPEVELLRSQLILKLRQHYRELCQQREGIEPPRESFNRWMLER
KVVDKGSDPLLPSNCEPVVSPSMFREIMNDIPIRLSRIKFREEAKRLLFKYAEAARRLIE
SRSASPDSRKVVKWNVEDTFSWLRKDHSASKEDYMDRLEHLRRQCGPHVSAAAKDSVEGI
CSKIYHISLEYVKRIREKHLAILKENNIPEEVEAPEVEPRLVYCYPVRLAVSAPPMPSVE
MHMENNVVCIRYKGEMVKVSRNYFSKLWLLYRYSCIDDSAFERFLPRVWCLLRRYQMMFG
VGLYEGTGLQGSLPVHVFEALHRLFGVTFECFASPLNCYFRQYCSAFPDTDGYFGSRGPC
LDFSPLSGSFEANPPFCEELMDAMVSHFEKLLESSPEPLSFIVFIPEWREPPTPALTRME
QSRFKRHQLVLPAFEHEYRSGSQHVCKKEEMHYKAVHNTAVLFLQNDPGFAKWGPTPERL
QELSSAYRQSGRSHGSSSSSSSENKDRDSGREQGPSREPHPT
Download sequence
Identical sequences M3Z1N6 U6CV49
ENSMPUP00000017498 XP_012908687.1.14098 XP_012908689.1.14098 ENSMPUP00000017498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]