SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017549 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017549
Domain Number 1 Region: 101-216
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.46e-21
Family Synaptotagmin-like (S variant) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017549   Gene: ENSMPUG00000017661   Transcript: ENSMPUT00000017808
Sequence length 246
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896916.1:6227070:6283682:1 gene:ENSMPUG00000017661 transcript:ENSMPUT00000017808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSFDDEDAGDSRRLKGAIQRSTETGLAVEMPSRTLRQASHESIEDSMNSYGSEGNLNYG
GVCLASDAQFSDFLGSMGPAQFVGRQTLATTPMGDVEIGLQERNGQLEVDIIQARGLTAK
PGSKTLPAAYIKAYLLENGVCIAKKKTKVARKSLDPLYNQVLLFPESPQGKVLQVIVWGN
YGRMERKQFMGVARVLLEELDLTTLAVGWYKLFPTSSMVDPAAGPLLRQASQLSLESTVG
PCGERS
Download sequence
Identical sequences F1PIB2 M3Z1T7
ENSCAFP00000014005 ENSMPUP00000017549 ENSCAFP00000014005 ENSMPUP00000017549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]