SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017557 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017557
Domain Number 1 Region: 95-343
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.78e-70
Family Nuclear receptor ligand-binding domain 0.00000000136
Further Details:      
 
Domain Number 2 Region: 26-109
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-30
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017557   Gene: ENSMPUG00000017669   Transcript: ENSMPUT00000017816
Sequence length 443
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896916.1:6574926:6607039:-1 gene:ENSMPUG00000017669 transcript:ENSMPUT00000017816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTSIWFDTSPSEGANLNAPNSLGVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKN
HMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYEDSSLPS
INALLQAEVLSQQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCEL
PLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSMRILDE
LVLPFQELQIDDNEYACLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSR
GRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSSSDAPHAHHPLHP
HLMQEHMGTNVIVANTMPSHLSNGQMCEWPRPRAQAATPETPQPSPPGGSGSEPYKLLPG
AIATIVKPPSAIPQPTITKQEVI
Download sequence
Identical sequences M3Z1U5
ENSMPUP00000017557 ENSMPUP00000017557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]