SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017573 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017573
Domain Number 1 Region: 58-205
Classification Level Classification E-value
Superfamily PH domain-like 4.55e-43
Family Phosphotyrosine-binding domain (PTB) 0.000000248
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017573   Gene: ENSMPUG00000017685   Transcript: ENSMPUT00000017832
Sequence length 593
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897126.1:433713:457934:1 gene:ENSMPUG00000017685 transcript:ENSMPUT00000017832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSAAASGGPRRPEQHLPPAPCGAPGPPETSRTEPEGAGTMNKLRQSLRRRKPAYVPEA
SRPHQWQADEDAVRKGTCSFPVRYLGHVEVEESRGMHVCEDAVKKLKAMGRKSVKSVLWV
SADGLRVVDDKTKDLLVDQTIEKVSFCAPDRNLDKAFSYICRDGTTRRWICHCFLALKDS
GERLSHAVGCAFAACLERKQRREKECGVTAAFDASRTSFAREGSFRLSGGGRPTEREAPE
KKKAEAAAAPTAAPGPAQPGHVSPTPATTSPGEKGEAGTPVAAGTSAAAIPRRHAPLEQL
VRQGSFRGFPALSQKNSPFKRQLSLRLNELPSTLQRRTDFQVKGTVPEMEPPGASDSDSI
NALCTQISSSFASAGAPAPGPPPAAAGTSAWGESSVPPATAFQPGHKRTPSEAERWLEEV
SQVAKAQQQQQQQTASVPPVAPALQPFPAPMGPFDAAPAQVAVFLPPPHMQPPFVPAYPG
LGYPPVPRVPVVGITPSQMVANAFCSAAQLQPQPATLLGKAGAFPPPAMATAPGGQARPR
PNGAPWPPEPAPAPAPELDPFEAQWAALEGKPAVEKPSNPFSGDLQKTFEIEL
Download sequence
Identical sequences M3Z1W1
XP_004776162.1.14098 ENSMPUP00000017573 ENSMPUP00000017573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]