SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017577 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017577
Domain Number 1 Region: 51-287
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-89
Family Calponin-homology domain, CH-domain 0.00000226
Further Details:      
 
Domain Number 2 Region: 2359-2477
Classification Level Classification E-value
Superfamily PH domain-like 4.38e-31
Family Pleckstrin-homology domain (PH domain) 0.00012
Further Details:      
 
Domain Number 3 Region: 304-424
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-29
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 4 Region: 1519-1674
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-28
Family Spectrin repeat 0.00097
Further Details:      
 
Domain Number 5 Region: 433-535
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-22
Family Spectrin repeat 0.00045
Further Details:      
 
Domain Number 6 Region: 800-932
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-22
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 7 Region: 1840-1996
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-22
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 8 Region: 1732-1885
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-21
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 9 Region: 1204-1356
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-19
Family Spectrin repeat 0.00088
Further Details:      
 
Domain Number 10 Region: 537-643
Classification Level Classification E-value
Superfamily Spectrin repeat 4.8e-18
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 11 Region: 694-789
Classification Level Classification E-value
Superfamily Spectrin repeat 3.34e-16
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 12 Region: 1430-1537
Classification Level Classification E-value
Superfamily Spectrin repeat 6.12e-16
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 13 Region: 990-1111
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000792
Family Spectrin repeat 0.00091
Further Details:      
 
Domain Number 14 Region: 1120-1220
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000023
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 15 Region: 1998-2060
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000331
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 16 Region: 1364-1462
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000115
Family Spectrin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017577   Gene: ENSMPUG00000017689   Transcript: ENSMPUT00000017836
Sequence length 2514
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897126.1:519798:588739:-1 gene:ENSMPUG00000017689 transcript:ENSMPUT00000017836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQVPGEVDNMEGLPAPNNNNPAARWESPDRGWEREQPAASTAAASLFECSRIKALADER
EAVQKKTFTKWVNSHLARVGCHIVDLYADLRDGFVLTRLLEVLSGEQLPRPTRGRMRIHS
LENVDKALQFLKEQRVHLENVGSHDIVDGNHRLTLGLVWTIILRFQIQVIKIETEDNRET
RSAKDALLLWCQMKTAGYPEVNIQNFTTSWRDGLAFNALIHRHRPDLVDFSKLTKSNANY
NLQRAFRTAEQHLGLTRLLDPEDVNMEAPDEKSIITYVVSFYHYFSKMKALAVEGKRIGK
VLDQVLEVGKIIERYEELAAELLAWIHRTVGLISNQKFANSLSGVQQQLQAFTAYCTLEK
PVKFQEKGNLEVLLFSIQSKLRACNRRLFVPREGCGIWDIDKAWGQLEKAEHEREAALRA
ELIRQEKLELLAQRFDHKVAMRESWLNENQRLVSQDNFGYELPAVEAAMKKHEAIEADIA
AYEERVQGVAELAQALAAEGYHDARRVAAQRDSVLRQWALLTGLVGARRTRLEQNLALQK
VFQEMVYMVDWMEEMQAQLLSRECGQHLVEAEDLLQKHGLLEGDIAAQSERVEALNAAAL
RFSQLQGYQPCDPQVICNRVNHVHGCLAELRDQAARRRADLEASRSLWALLQELEEAESW
ARDKERLLEAAGGGGGGGAAGTGXGAETVHLAGLAERAASARRRWQRLEEAAARRERRLQ
EARALHQFGADLDGLLDWLRDAYRLAAAGDFGHDEASSRRLARQHRALTGEVEAHRGPVG
GLRRQLATLGGASGAGPLVVALQVRVVEAEQLFAEVTEVAALRRQWLRDALAVYRMFGEV
HACELWIGEKEQWLLAMRVPDSLDDVEVVQHRFESLDQEMNSLMGRVLDVNHTVQELVEG
GHPSSDEVRSCQDHLNSRWNRIVELVEQRKEEMSAVLLVENHVLEVAEVRAQVREKRRAV
DSAPRAGGALQWRLSGLEAALQALEPRQAALQEEAALLAVRFPAQAARLHQGAEELNAEW
GALASAAQACGEAVAAAGRLQRFLHDLDAFLDWLVRAQEAAGGIEGPLPSSLEEADALLA
RHAALKEEVDQREEDYARIVAASEALLAADGAELGPGLALDEWLPHLELGWHKLLGLWEA
RREALVQSHVYQLFLRDLRQACAVLHNQEMALSGPELPGTVETVEEALKRHRDFLTTMEL
NQQKMQVAVQAAEGLLRQGNIYGEQAQEAVTRLLEKSQENQLRAQQWMQKLHDQLGLQHF
LRDCHELDGWIHEKMLMARDGTREDGHKLHKRWLRHQAFMAELAQNKEWLEKIEREGQQL
MQEKPELAASVRKKLGEIRQCWAELESTTQAKARQLFEASKADQLVQSFAELDKKLLHME
SQLQDVDPGGDLATVNSQLKKLQSMESQVEEWYREVGELQAQTAALPLEPASKELVGERQ
NAVGERLVRLLEPLQERRRLLLASKELHQVAHDLDDELAWVQERLPLAMQTERGSGLQAV
QQYIKKNQGLRREIQAHGPRLEEVLERAGALASLRSPEAEAVRRGQEQLQGAWAGLREAA
ERRQQVLDAAFQVEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGV
ENYEESIAQLSRQCRALLEMGHPDSEQISRRQSQVDRLYVALKELGEERRVGLEQQYWLY
QLSRQVDELEHWIAEKEVVAGSPELGQDFEHVTVLQEKFSEFANETGTAGRERLAAVNQM
VDELIECGHTAAATMAEWKDGLNEAWAELLELMGTRAQLLAASRELHKFFSDARELQGQI
EEKRRRLPRLTAPPEPRPSASSMQRTLRAFEHDLQLLVSQVRQLQEGAAQLRTVYAGEHA
EAIASREQEVLQGWKELLAACEDARLHVSSTADTLRFHSQARDLLSWMDGIASQIGAADK
PRDVSSVEVLMNYHQGLKTELEARVPELTACQELGRSLLLNKSAMADEIQAQLDKLGTRK
EEVSDKWDRHWEWLQQMLEVHQFAQEAVVADAWLTAQEPILQSRELGSSVDEVEQLIRRH
EAFRKAAAAWEERFSSLRRLTTIEKLKAEQSKQPPTPLLGRKFFGDPTELAAKAAPLLRP
GGYERGLEPLARRASDTLSAEVRTRVGYVRQELKPERLQPRIDRLPEIPGRVEPPAPPSV
PEDVAETPGPLPVAEQVRLRPERQESADRAEELPRRRRPERQDRADQSEEAARRRRPERQ
ESAEHEAAHSLTLGRYEQMERRRERRERRLERQESSEQEMPTRGELAKGKATLADIVEQL
QEKEAGPALPVGPSLPQPRELPPGRLPNGLEPPERTPRPARRRARARPKPRRRPRPREGG
EGGGSRRSRSAPAQGGSAPAPPPPPTHTVQHEGFLLRKRELDANRKSSNRSWVSLYCVLS
KGELGFYKDAKGPASRGTHGGEPLLSLHRATSEVASDYKKKKHVFKLQTQDGSEFLLQAK
DEEEMNGWLEAVAASVGEHAEIARWGQTLPTTSSTDEGNPKREAGERRASGRRK
Download sequence
Identical sequences M3Z1W5
ENSMPUP00000017577 ENSMPUP00000017577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]