SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017596 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017596
Domain Number 1 Region: 107-191
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000519
Family PDZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017596   Gene: ENSMPUG00000017707   Transcript: ENSMPUT00000017855
Sequence length 1478
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897126.1:631468:646368:1 gene:ENSMPUG00000017707 transcript:ENSMPUT00000017855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMLTFFFSEPGTQEAQGAGRDPEVARPQRKGVSPADDCACATPQAGLLLGGGACAQAAA
QRQLLHAELKLVLQQKGERKQEPGARVTPSCAMEARSRSAEELRRAELVEIIVETEAQTG
VSGINVAGGGKEGIFVRELREDSPAARSLSLQEGDQLLSARVFFENFKYEDALRLLQCAE
PYKVSFCLKRTVPTGDLALRPGTVAGYEIKGPRAKVAKLNIQSLSPVKKKKMVMPGALGA
PADLAPVDVEFSFPKFSRLRRGLKAEAPKGPVPAAPARRRLQLPRLRVREVAEEAQAARL
AAAAPPPRKAKVEAEVAAGARFTAPQVELVGPRLPGSEVGVPQVSAPKGLGEVALHLPSL
GLGAPAAPAVEPVALGIQVPQVELPTLPSLPTLPTLPCLETREGAAAVTVPTLDVAAPAV
GVDLALPGVEVEARGEVPEVALKMPRLSFPRFGTRAKEVAEAKVVKGSPEARVKGPKLRM
PTFGLSLLEPRPAAAETAVESKLKLPTIKMPSFGLGVSAPEVKVPKGPEVKLPKVPEMAV
PEVRLPDVQLPKVPEMKLPKVPEMAVPEVQLPDVQLPKVPEMKLPEMKLPKVPEMAVPEV
RLPDVQLPKVPEMKLPEMKLPKVPEMAVPEVRLPEVQLPKVPEMKLPEMKLPKVPEMAVP
EVRLPDVQLPKVPEMKLPEMKLPKVPEMAVPDVQLPEVGLPKVSEMKLPKVPEMAVPEVR
LPDVQLPKVPEMKLPEMKLPEMKLPEIKLPKVPEMAVPDVHLPEVQLPKVSEMRLPEMQV
PKVPEVHLLKAPEVKLPKAPEVQLKAEQAEGMEFGFKMPKMTMPKLGRAESPLRGKAGEA
GAEVSGKRVTLPCLQPEVGPEARVGVSTLTLPSVELDLPRALSLEGQVPAAEMGKVERAE
GPGVATGVGEVAFRMPSVEIVTPQLPTVEVEEGRLEVTEMKVKPSSKFSLPKFGLSGPKV
PKAEAEGAERATKLKVSKFAISLPKARAGTEVEVKGAGEAGLLPALDLSIPQLSLDARLP
TGKVEVAGADVKVKGPRFALPKFGVKGRDAEAGELAPGVAELESKGWGWDGKVKMPKLKM
PSFGLARGKEAEIQGGRVSPGEKPESVAGPLKIPEVELVTLGAQEEGRAEGAVAVGGVQL
SGPQVSVTRPAGTEGQEGALRMPLGISLPQVELSGFGEAGLGTTAGPQVKGAAQSVEGAA
GYRVQVPQVTLSLPGAQVAGGELLVGEGVFKMPAVSVPQVELDVGLGREVQVGEAATGEG
GLRLKVPTLGARAEAGEEGSGDQSPGAERTFHLSLPDVEISPPTVGGHAEYQVAEGDGEA
GHKLKVRLPRFGLVRAKEGVEEGEKTKSPKLRLPRVGFSQSEAVPGESSPSPEEEEEEGG
GEGASGRRGRVRVRLPRVGLATPSKASRGQEGEAGPKSPSGEKSPKFRFPRVSLSPKARS
GSGDQEEGGFRVRLPSVGFSDTGAPGPARMEGAQAAVV
Download sequence
Identical sequences M3Z1Y4
ENSMPUP00000017596 ENSMPUP00000017596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]