SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017599 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017599
Domain Number 1 Region: 147-461
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-99
Family Protein kinases, catalytic subunit 0.0000000000185
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-25
Family Pleckstrin-homology domain (PH domain) 0.000000966
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017599   Gene: ENSMPUG00000017710   Transcript: ENSMPUT00000017858
Sequence length 481
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897126.1:672996:750458:1 gene:ENSMPUG00000017710 transcript:ENSMPUT00000017858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPDAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGEDPM
DYKCGSPSDPSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKASGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAREVMEHRFFVSVSWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
Download sequence
Identical sequences M3Z1Y7
XP_004776194.1.14098 XP_004776195.1.14098 XP_004776196.1.14098 ENSMPUP00000017599 ENSMPUP00000017599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]