SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017619 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017619
Domain Number 1 Region: 4-139
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 8.92e-44
Family Cofilin-like 0.000000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017619   Gene: ENSMPUG00000017730   Transcript: ENSMPUT00000017878
Sequence length 142
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897126.1:1174094:1184606:1 gene:ENSMPUG00000017730 transcript:ENSMPUT00000017878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSLVVCEVDPELKEKLRKFRFRKETDNAAMIMKVDKDRQMVVLEEEFQNISPEELKTE
LPERQPRFVVYSYKYVHEDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKV
FEIRTTDDLTEAWLQEKLSFFR
Download sequence
Identical sequences M3Z207
ENSMPUP00000017619 XP_004776239.1.14098 XP_004776240.1.14098 XP_012903169.1.14098 XP_012903170.1.14098 ENSMPUP00000017619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]