SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017628 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017628
Domain Number 1 Region: 1068-1268,1306-1355,1382-1474
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 1.96e-39
Family Rap/Ran-GAP 0.0058
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000017628
Domain Number - Region: 142-171,503-628,655-696,754-868
Classification Level Classification E-value
Superfamily ARM repeat 0.0115
Family HspBP1 domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017628   Gene: ENSMPUG00000017739   Transcript: ENSMPUT00000017887
Sequence length 1495
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896916.1:11494358:11562007:-1 gene:ENSMPUG00000017739 transcript:ENSMPUT00000017887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSEWRSLHLVIQNDQGHTSVLHSYPESVGREVANAVVHPLGQALGTPSVAGSESLLKTD
KEVKWTMEVICYGLTLPLDGETVKYCVDVYTDWIMALVLPKDSIPLPVIKEPNLYVQSIL
KHLQNLFVPRQEQGSSQIRLCLQVLRAIQKLARESSIMARETWEVLLLFLLQINDILLAP
PTVQGGIAENLAEKLIGVLFEVWLLACTRCFPTPPYWKTAKEMVANWRHHPAVVEQWSKV
TCALTSRLLRFTYGPSFPPFKVPDEDASLIPPEMDNECVAQTWFRFLHMLSNPVDLSNPA
IISSTPKFQEQFLNVSGMPQELNQYPCLKHLPQIFFRAMRGISCLVDAFLGISRPRSDSA
PPTPVNRLSMPQSTAVSTTPPHNRRHRAVTVNKATMKTSTVSTAHASKVQHQTSSTSPLS
SPNQTSSEPRPLPAPRRPKVNSILNLFGSWLFDAAFVHCKLHNGINRDSSMTAITTQASM
EFRRKGSQMSTDTMVSNPMFDASEFPDNYEAGRAEACGTLCRIFCSKKTGEEILPAYLSR
FYMLLIQGLQINDYVCHPVLASVILNSPPLFCCDLKGIDVVVPYFISALETILPDRELSK
FKSYVNPTELRRSSINILLSLLPLPHHFGTVRSEVVLEGKFSNDDSSSYDKPITFLSLKL
RLVNILIGALQTETDPNNTQMILGAMLNIVQDSALLEAIGCQMEMGGGENNLKSHSRTNS
GISSASGGSTEPTTPDSERPAQALLRDYALNTDSAAGLLIRSIHLVTQRLNSQWRQDMSI
SLAALELLSGLAKVKVMVDSGDRKRAISSVCSYIVYQCSRPAPLHSRDLHSMIVAAFQCL
CVWLTEHPDMLDEKDCLKEVLEIVELGISGSKSKNSEQEVKYKGDKEPNPASMRVKDAAE
ATLTCIMQLLGAFPSPSGPASPCSLVNETTLIKYSRLPTINKHSFRYFVLDNSVILAMLE
QPLGNEQNDFFPSVTVLVRGMSGRLAWAQQLCLLPRGAKANQKLFVPEPRPVPKNDVGFK
YTVKHRPFPEEVDKIPFVKADLSIPDLHEIVTEELEERHEKLRNGMTQQIAYEVHLEQQS
EEELRKRSFPDPVTDCKPPPPAQEFQTARLFLSHFGFLSLEALKEPANSRLPPHLIALDS
TIPGFFDDIGYLDLLPCRPFDTVFIFYMKPGQKTNQEILKNVESSRNVQPHFLEFLLSLG
WSVDVGRHPGWTGHVSTSWSINSCDNGEGPEQDEVISSEDVGASIFNGQKKVLYYADALT
EIAFVVPSPVESLTDSLESNISDQDSDSNMDLMPGILKQPSLTLELFPNHTDNLNSSQRL
SPSSRMKKLPQGRPVPPLGPETRVSVVWVERYDDIENFPLSDLLTEISTGVETTANSSTS
LRSTTLEKEVPVIFIHPLNTGLFRIKIQGATGKFNMVIPLVDGMIVSRRALGFLVRQTVI
NICRRKRLESDSYSPPHVRRKQKITDIVNKYRNKQLEPEFYTSLFQEVGLKNCTS
Download sequence
Identical sequences M3Z216
ENSMPUP00000017628 XP_004746499.1.14098 ENSMPUP00000017628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]