SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017645 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017645
Domain Number 1 Region: 146-462
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.37e-126
Family Transglutaminase core 0.0000000000374
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily E set domains 7.7e-43
Family Transglutaminase N-terminal domain 0.000000784
Further Details:      
 
Domain Number 3 Region: 469-585
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.88e-34
Family Transglutaminase, two C-terminal domains 0.00000201
Further Details:      
 
Domain Number 4 Region: 586-686
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 9.68e-27
Family Transglutaminase, two C-terminal domains 0.00000658
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017645   Gene: ENSMPUG00000017757   Transcript: ENSMPUT00000017905
Sequence length 687
Comment pep:known scaffold:MusPutFur1.0:GL896916.1:11847078:11880338:1 gene:ENSMPUG00000017757 transcript:ENSMPUT00000017905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDLVLKNCDLELEVNGRDHHTAELCRERLVVRRGQPFWLTLHFEGRSYEASVDSLTFS
AVTGPAPSEEAGTKARFPLSSAMEEGAWTAVVMDQQDGVLSLQLSTPANAPVGLYRLTLE
ASTGYQGSSFVLGHFTLLFNTWCPADAVYLDSEEEREEYVLTQQGFIYQGSVKCIKSIPW
NFGQFEDGILDICLALLDTNPKFLKDAGRDCSRRSSPVYMGRVVSAMVNCNDDQGVLLGR
WDNDYKDGVSPMFWIGSVDILRRWKTSGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
FNSAHDQNSNLLIEYVYNEFGEMQRDKSEMIWNYHCWTESWMSRPDLQPGYGGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLNTKYDAPFVFAEVNADVVNWIQQKDGSMHESTNTAL
TVGMKISTKRVGRDEREDITHNYKYPEGSPEEREAFKRANHLNKLTKKEETGVAMRIRVA
QSMNMGSDFDVFAYITNNTAETHTCRLMLHARTVSYNGILGPECGSKDLLNLSLEPSSEK
SIPLRILYDKYCECLTESNLIKVRGLLIEPAANSYLLAERDIYLENPEIKIRILGEPKQN
RKLVAEASLRNPLTTPLLGCTFTMEGAGLMDEQKIVDVPDAVAEGKEVKVRVDLMPRHVG
RHKLVVNFESDKLKSVKGFRNVIIGPA
Download sequence
Identical sequences G9KT55
XP_004746510.1.14098 ENSMPUP00000017645 ENSMPUP00000017645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]