SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017650 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017650
Domain Number 1 Region: 259-529
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-82
Family Protein kinases, catalytic subunit 0.0000000000891
Further Details:      
 
Domain Number 2 Region: 146-290
Classification Level Classification E-value
Superfamily SH2 domain 3.22e-39
Family SH2 domain 0.00000117
Further Details:      
 
Domain Number 3 Region: 64-156
Classification Level Classification E-value
Superfamily SH3-domain 3.47e-25
Family SH3-domain 0.0000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017650   Gene: ENSMPUG00000017762   Transcript: ENSMPUT00000017910
Sequence length 536
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896916.1:12478014:12511012:-1 gene:ENSMPUG00000017762 transcript:ENSMPUT00000017910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSNKSKPKDASQRRRSLEPAENTHGGGGGAFPTSQTPSKPASADGHRGPSTAFPSAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Download sequence
Identical sequences E2RSH8 M3W6V8 M3Z238
XP_003983533.1.62641 XP_004746524.1.14098 XP_006733705.1.47382 XP_007077761.1.5354 XP_008696339.1.72690 XP_008696340.1.72690 XP_008696341.1.72690 XP_019314088.1.44245 XP_021544936.1.83697 XP_021544937.1.83697 XP_865870.1.84170 ENSCAFP00000012903 ENSMPUP00000017650 ENSFCAP00000006486 ENSMPUP00000017650 ENSCAFP00000012903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]