SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017670 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017670
Domain Number 1 Region: 300-442
Classification Level Classification E-value
Superfamily PH domain-like 7.68e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 196-301
Classification Level Classification E-value
Superfamily Second domain of FERM 3.66e-37
Family Second domain of FERM 0.00000422
Further Details:      
 
Domain Number 3 Region: 116-195
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.47e-27
Family First domain of FERM 0.0000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017670   Gene: ENSMPUG00000017782   Transcript: ENSMPUT00000017930
Sequence length 886
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896916.1:13461710:13556831:-1 gene:ENSMPUG00000017782 transcript:ENSMPUT00000017930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGPSSCLHLSWGVLVTMTTETGPDSEVKKAQEEAPQQPEAAATATTPVTPAGHSGHPEA
NSNEKHPPQQDTRPAGQSLDMEEKGYGEADGLSERTTPSRAQKSPQKIAKKYKSAICRVT
LLDASEYECEVEKHGRGQVLFDLVCEHLNLLEKDYFGLTFCDADSQKNWLDPSKEIKKQI
RSSPWNFAFTVKFYPPDPAQLTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQA
ELGDYDAEEHVGNYVSELRFAPNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKLSM
YGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGE
YEQFESTIGFKLPNHRSAKRLWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQAQ
TRQASALIDRPAPFFERSSSKRYTMSRSLDGAEFSRPASVSENHDTGPDGDKQEEDGESG
GRRSEAEEGEVRTPTKIKELKFLDKPEDVLLKHQASINELKRTLKEPNSKLVHRDRDWER
ERRLPSSPASPSPKGTPEKVNERAGLREGSEEKVKPPRPRAPESDTGDEDQDQERDAVFL
KDNHLAIERKCSSITVSSTSSLEAEVDFTVIGDYHGSAFEDFSRSLPELDRDKSDSETEG
LVFSRDLNKGGLGQEDESGGIEDSPERGACATPDMPQFESVKAETMTVSSLAIRKKIEPE
AVLQTRVSAMDASQVDGTAPGGKESITTTPSITTETISTTMENSLKSGKGAAAMIPGPQT
VATDIRSLSPIIGKDVLTSTYGATAETLSTSTTTHVTKTVKGGFSETRIEKRIIITGDED
VDQDQALALAIKEAKLQHPDMLVTKAVVYRETDPSPEERDRKPQES
Download sequence
Identical sequences M3Z258
ENSMPUP00000017670 ENSMPUP00000017670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]