SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017680 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017680
Domain Number 1 Region: 25-239
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.3e-80
Family Calponin-homology domain, CH-domain 0.0000141
Further Details:      
 
Domain Number 2 Region: 257-379
Classification Level Classification E-value
Superfamily Spectrin repeat 4.14e-35
Family Spectrin repeat 0.00000061
Further Details:      
 
Domain Number 3 Region: 493-611
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-30
Family Spectrin repeat 0.00000538
Further Details:      
 
Domain Number 4 Region: 380-488
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-25
Family Spectrin repeat 0.00000335
Further Details:      
 
Domain Number 5 Region: 617-729
Classification Level Classification E-value
Superfamily Spectrin repeat 4.03e-23
Family Spectrin repeat 0.00000287
Further Details:      
 
Domain Number 6 Region: 722-854
Classification Level Classification E-value
Superfamily EF-hand 1.41e-22
Family EF-hand modules in multidomain proteins 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017680   Gene: ENSMPUG00000017792   Transcript: ENSMPUT00000017940
Sequence length 882
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897126.1:1627251:1687132:-1 gene:ENSMPUG00000017792 transcript:ENSMPUT00000017940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCWNTSHTIAFVSSASGRNKEDIVTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLE
VISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTI
ILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPEL
IEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFS
GAQKAETAANRICKVLAVNQENEHLMEDYERLASDLLEWIRRTIPWLEDRVPQKTIQEMQ
QKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNGWQH
LEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLKHRDYETATLSDI
KALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRCQKICDQWDALGSLT
QSRREALEKTEKQLETIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISA
HDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQL
VPKRDHALLEEQSKQQSNEHLRRQFASQANIVGPWIQTKMEEIGRISIEMNGTLEDQLNH
LKRYERSIVDYKPNLDLLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINE
VENQILTRDAKGISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGDA
EFNRIMSVVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNFITAEELRR
ELPPDQAEYCIARMAPYQGPDAVPGALDYKSFSTALYGESDL
Download sequence
Identical sequences M3Z268
ENSMPUP00000017680 ENSMPUP00000017680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]