SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017682 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017682
Domain Number 1 Region: 1446-1569
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.67e-26
Family Synaptotagmin-like (S variant) 0.045
Further Details:      
 
Domain Number 2 Region: 227-361
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.91e-19
Family Synaptotagmin-like (S variant) 0.024
Further Details:      
 
Domain Number 3 Region: 954-1089
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.55e-19
Family Synaptotagmin-like (S variant) 0.046
Further Details:      
 
Domain Number 4 Region: 1660-1821
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.04e-17
Family Synaptotagmin-like (S variant) 0.02
Further Details:      
 
Domain Number 5 Region: 388-558
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000104
Family PLC-like (P variant) 0.091
Further Details:      
 
Domain Number 6 Region: 3-99
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000143
Family Synaptotagmin-like (S variant) 0.025
Further Details:      
 
Domain Number 7 Region: 1119-1227
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000807
Family Synaptotagmin-like (S variant) 0.047
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000017682
Domain Number - Region: 1951-1989
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0497
Family ABC transporter transmembrane region 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017682   Gene: ENSMPUG00000017794   Transcript: ENSMPUT00000017942
Sequence length 1996
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896916.1:13974308:14008776:1 gene:ENSMPUG00000017794 transcript:ENSMPUT00000017942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTVCVRRLTGLPGTHDRQVRLSFRGFTQKTRRIRCGQEADISELFRWPHYGAPLVEEC
LSVQVVNCSRVFSPRSLGTLVISLQQLQSTGHLVLREALVDENLRVTPIQVELDLKYRPP
EGATGAWAEEDFGASIRDSSELIIPNVGFQELEPREAQLERRAVALGHRLARGLGQQDDE
DELELELEDDPDVELSGVVFSHLKSRARGLARGDPFQACEARDFQVGVTVLEAQKLVGVN
INPYVAVRVGEQRRVTATQRGTNCPFYNEYFLFEFHETRLHLQDLLLEITAFHSQTLPFM
ASRIGTFRMDLGIIFDQPDAHFYQKWAPLHDPRDTRAGTKGFVKVTLSVRARGDLPPPLP
APGPGHSSDIEKNLLLPRRVPAQRPWARLRVRVYSAEGLPALRPGLLGSLARALQEQRVF
MDPYVRVSFLGQQGETSVRGETAAPEWNEQLSFVELFPPLTRGLRLQLRDDAPLVDVAVA
THVLDLRQISHPGRAAGFNPTFGPAWVPLYGSPPSAGLRDGLQSLNEGLGQGIWFRGRLL
LAVSMEVSEGRAEPEPPQAPQRPRLSRLMRKKKKARRGQTPTGIPQPLDASSSGDGPEIP
SAMEVEVEELLPLPENALAPLQDFLLFGVLFEATMIDPALASQPISFEISIGGAGRREEQ
PGRGARAGEGAEGVAGEAEPLLESEVGVRPVEEGEELGTPAQRPEPMDGNGPYFCLPLRH
RKPCVRVWSRWEDHTWRLQSTNCVRKVAERLDQGLQEVETLQRRPGAGACTRLKQALEEL
VAGSRQFCHSAERRTMTRPNTLDRCRGKLLVYSLNLLAKQGLRLLQGLRQGNVQERVALT
KKLLAKLHFLAQEPQPPLPDVLVWMFSGQRRVAWARIPAQDVLFSVVEEERGQDCGKIQS
LLLTAPGAAPGEVCAKLELFLWLGLGKQAKACTSELPRDLLPEPSEGLPHHLYRDDFSYF
QLRAHLYQARGVLAADDSGLSDPFARVLISTQCQTTRVLEQTLSPLWDELLVFDQLIIDG
RREHLQEEPPLVLINVFDHNKFGPPVFLGRALASPRVKLMEDPYQRPELQFFPLRKGPRT
AGELIATFELIELDYSGRLEPSVPSDVEPQDLTPLVEHLSGRLSLPPDVRPVLREFRVEV
LFWGLRGLGRVHLFEVEQPQVVLEVAGRRVESEVLASYRENPNFTELVRHLTVDLPEQPY
LQPPLSILVIERRAFGRTVLVGSHVVSHMLRFILRGHEDLPEEEGQEEEAGDLMLKGPQG
QKSLGPFLTEVGMPRRQLKAPLKKFPLGSLLNQGPELEEEVPDPEELDWWSKYYASLQEL
RGQTNFEEDELDDPGESDGVHLISVAGEARDQGQGEAEVQGSAVSQKKAVPTLKIYSGTL
EEEFNHFEDWLNVFPLYRGQGGQDGDGEQEGSGHPVGKFKGSFLIYPESDAVSFSEPQIS
RGVPQNRPIKLLVRVYVVKATNLAPADPNGKADPYVVVSAGRERQDTKERYIPKQLNPIF
GEVLELSVSLPAEPELTVAVFDHDLVGSDDLIGETHIDLENRFYSHHRANCGLASQYDVD
GYNAWRDAFRPSQILAGLCQRCGLPGPEYRAGAVKVGSKVFLTPPETLPPGRGGPKVTSE
VPEEAQALLVLRRWQEMPELGIQLVPEHVETRPLYHPRSPGLLQGSLHMWIDIFPRDVPA
PPPVDIKPRQPISYELRVIIWNTEDVVLDDVNPLTGELSSDIYVKSWVKGLEHDKQETDV
HFNSLTGEGNFNWRFVFRFDYLPTEREVSVRRRPGPFALEEAEFRQPAVLVLQVWDYDRI
SANDFLGSLELQLPDMVRGARGPELCSVRLARDGAGPRCNLFRCRRLRGWWPVVKLREPE
DEEREQREAPGGKKRQRKKRKGRPEDLAFTDPGGHVHVLTGKVEAEFELLTVEEAEKRPV
GKGRKEPEPLDKPNRPKTSFNWFVNPLKTFVFFIWRRYWRILVLLLLLALVTVFLLLVFY
TMPGQISQVIFRPLHQ
Download sequence
Identical sequences M3Z270
ENSMPUP00000017682 ENSMPUP00000017682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]