SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017705 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017705
Domain Number 1 Region: 507-874
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.62e-137
Family Hect, E3 ligase catalytic domain 0.00000000000861
Further Details:      
 
Domain Number 2 Region: 35-157
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.02e-25
Family PLC-like (P variant) 0.000000874
Further Details:      
 
Domain Number 3 Region: 411-449
Classification Level Classification E-value
Superfamily WW domain 0.00000000000000542
Family WW domain 0.00041
Further Details:      
 
Domain Number 4 Region: 334-368
Classification Level Classification E-value
Superfamily WW domain 0.00000000000139
Family WW domain 0.0011
Further Details:      
 
Domain Number 5 Region: 302-335
Classification Level Classification E-value
Superfamily WW domain 0.00000000000209
Family WW domain 0.0012
Further Details:      
 
Domain Number 6 Region: 452-487
Classification Level Classification E-value
Superfamily WW domain 0.0000000000115
Family WW domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017705   Gene: ENSMPUG00000017816   Transcript: ENSMPUT00000017965
Sequence length 880
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896916.1:14889196:15016164:-1 gene:ENSMPUG00000017816 transcript:ENSMPUT00000017965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYCWILLASILICRPIGGMSGSGSQLGSMGSLTMKSQLQITVISAKLKENKKNWFGPSPY
VEVTVDGQSKKTEKCNNTNSPKWKQPLTVIVTPVSKLHFRVWSHQTLKSDVLLGTAALDI
FETLKSNNMKLEEVVVTLQLVGDKEPTETIGDLSVCLDGLQLDSEVVTNGETTCSESASQ
SDDGSRPKDETRTNTNGSDEPEDAGAGENRKVNGNNSPSLSNGGFKPSRPPRPSRPPPPT
PRRPASVNGSPSATSESDGSSTGSLPPTNINSNTSEGATSGLIIPLTISGGSGPRPLNPV
PQAPLPPGWEQRVDQHGRVYYVDHIEKRTTWDRPEPLPPGWERRVDNMGRIYYVDHFTRT
TTWQRPTLESVRNYEQWQLQRSQLQGAMQQFNQRFIYGNQDLFTTSQNKEFDPLGPLPPG
WEKRTDSNGRVYFVNHNTRITQWEDPRSQGQLNEKPLPEGWEMRFTVDGIPYFVDHNRRT
TTYIDPRTGKSALDNGPQIAYVRDFKAKVQYFRFWCQQLAMPQHIKITVTRKTLFEDSFQ
QIMSFSPQDLRRRLWVIFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQ
INPASYINPDHLKYFRFIGRFIAMALFHGKFIDTGFSLPFYKRILNKPVGLKDLESIDPE
FYNSLIWVKENNIEECGLEMYFSVDKEILGEIKSHDLKPNGGNILVTEENKEEYIRMVAE
WRLSRGVEEQTQAFFEGFNEILPQQYLQYFDAKELEVLLCGMQEIDLNDWQRHAIYRHYT
RTSKQIMWFWQFVKEIDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIEKVGKEN
WLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE
Download sequence
Identical sequences M3Z293
ENSMPUP00000017705 ENSMPUP00000017705 XP_012908836.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]