SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017715 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017715
Domain Number 1 Region: 9-278
Classification Level Classification E-value
Superfamily Ras GEF 2.88e-78
Family Ras GEF 0.00072
Further Details:      
 
Domain Number 2 Region: 345-410
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.12e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000017715
Domain Number - Region: 285-317
Classification Level Classification E-value
Superfamily EF-hand 0.0015
Family Calmodulin-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017715   Gene: ENSMPUG00000017826   Transcript: ENSMPUT00000017975
Sequence length 490
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897126.1:1850566:1858486:1 gene:ENSMPUG00000017826 transcript:ENSMPUT00000017975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPGLGKKRKVSLLFDHLETGELAQHLTYLEFRSFQAITPQDLRGYVLQGSVRGCPSLE
GSVGLSNSVSRWVQVMVLSRPGPAQRAQVLDKFIQVAQRLHQLQNFNTLMAVTGGLCHSA
ISRLKDSHAHLSPDSTKALLELSELLAAHNNYTRYRRAWADCTGFRLPVLGVHLKDLVSL
HEAQPDRLPDGRVHLPKLNSLYLRLQELAALQRQQPPCSASEDLLHLLTLSLDLFYTEDE
IYELSYAREPRCPKSLPPSPFKAPLVVEWAPGVTPKPDRATLGRHVEQLVESVFKNYDPE
GRGTISQEDFERLSGNFPFACHGLHPPPRQGNGSYSREELTGYLLRASAICAKLGLAFLH
TFQEVTFRKPTFCDSCNGFLWGVTKQGYRCRDCGLCCHKHCRDRVKVECKKRPVAKGDVS
PPGAPIPPTPVPHTSCGSEDSLSYTLSLEPETGCHLCHAWTQTEPPHLEAETVPLPTTAS
PPSQPSKPNS
Download sequence
Identical sequences M3Z2A3
ENSMPUP00000017715 ENSMPUP00000017715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]