SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017717 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017717
Domain Number 1 Region: 13-125
Classification Level Classification E-value
Superfamily PH domain-like 1.9e-34
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017717   Gene: ENSMPUG00000017828   Transcript: ENSMPUT00000017977
Sequence length 417
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897126.1:1867102:1872912:-1 gene:ENSMPUG00000017828 transcript:ENSMPUT00000017977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETDEGGYGEDRYMVQVRAVVMARDDSSGGWLPVGGGGLSQVSVCRVRGARPEGGARQGHY
VIHGERLRDQKTTLECTLRPGLVYNKVNPIFHHWSLGDCKFGLTFQSPAEADEFQKSLLA
ALAALGRASSSSSSSSPSQDTAETPCPLTSHVDSESSSSHSHQETPPTAAAATIITVESA
SGFGPATSPQRRHSSAQSYPPLLPFTGIPEPSEPLTGAGGPGWGGRGYEDYRRAGPPAPL
TLSTCVVRFAKTGALRGTALGPPATLPAPLAEAAPPAPPARPPPGPGPAPAPAKASPEAE
EAARCVHCRALFRRRADGRGGRCAEAPDPGRLLVRRLSCLWCAESLLYHCLSDAEGDFSD
PCACEPGHPRPAARWAALAALSLAVPCLCCYAPLRACHWVAARCGCAGCGGRHEEAA
Download sequence
Identical sequences M3Z2A5
ENSMPUP00000017717 ENSMPUP00000017717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]