SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017721 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017721
Domain Number 1 Region: 161-269
Classification Level Classification E-value
Superfamily PH domain-like 9.59e-37
Family Pleckstrin-homology domain (PH domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 78-185
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-25
Family PDZ domain 0.0000613
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000017721
Domain Number - Region: 293-401
Classification Level Classification E-value
Superfamily PH domain-like 0.000756
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017721   Gene: ENSMPUG00000017832   Transcript: ENSMPUT00000017981
Sequence length 505
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896916.1:15870846:15904059:1 gene:ENSMPUG00000017832 transcript:ENSMPUT00000017981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGRRSPRTGLLELRAGAGSGAGGERWQRVLLSLAEDALTVSPADGEIGPEPGAPREPE
PAQLNGAAEPGAAPPQLPEALLLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKG
LAADQTEALFVGDAILSVNGEDLSSATHDEAVQVLKKTGKEVVLEVKYMKEVSPYFKNSA
SGTSVGWDSPPASPLQRQPSSPGPPPRDLSDAKRVSLKMAYVSRRCTPSDPEPRYLEICS
ADGQDTLFLRAKDEASAKSWAAAIQAQVNTLMPWVKDELQALLAATSTAGSQDIKHIGWL
TEQLPSGGTAPTLALLTEKELLLYCHLPQTREALSQPARSAPLIATRLVHSGPSKGSVPY
DTELSFALRTGTRHGVDTHLFSVESPQELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRP
CSLSVHIDKGFTLWAAEPGAARAVLLRQPFEKLQMSSDDGASLLFLDFGGAEGEIQLDLH
SCPKTMVFIIHSFLSAKVTRLGLLA
Download sequence
Identical sequences M3Z2A9
ENSMPUP00000017721 ENSMPUP00000017721 XP_004746679.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]