SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017736 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017736
Domain Number 1 Region: 487-832
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 5.36e-115
Family Rap/Ran-GAP 0.000000474
Further Details:      
 
Domain Number 2 Region: 956-1035
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000769
Family PDZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017736   Gene: ENSMPUG00000017847   Transcript: ENSMPUT00000017996
Sequence length 1777
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897126.1:2027351:2169462:-1 gene:ENSMPUG00000017847 transcript:ENSMPUT00000017996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTYRPIPNDGVDLAASCGARGADVLPGPHTGDYAPMGFWVQNGGMPQPIGESPVSATTR
PSPTTPAVPKMGVRARVADWPPKREALREQNNPSPSQDSDGTKATKVAHSMRGMQNGQPP
VSTPASSGPKAFHRLSRRRSKDVEFQDGWPRSPGRAFLPLRHRSSSEITLSECDVEDTGE
PRGPRHTGALPLFREYGSTSSIDVQGVPEQSFFDILNEFRSEQPDAAGPQSLRELLQADT
GPHGPGGSGGAKGDPRNGQPTKDSLLGLQPAKEKDKARKKAVRGLGGGDAADSSIFRKLR
SVKADGEAARAPGEAEEGRSAPDTGRPWVCQKSFAHFDVQSMLFDLNEAAANRVATAQRR
NTTTGASAASATAALPASRAHGLGGLDAAFPSTEDLNCKENLEQDLGDDNSNDLLLSCPH
FRNEIGGECERNVSFSRAAVGSPGGGGGGGEGRPAEPTLSAHRTNASISVLEVPKEQQRT
QSRPRQYSIEHVDLGARYYQDHFVGREHANYFGVDEKLGPVAVSIKREKLEDHKDHGPQY
QYRIIFRTRELITLRGSILEDATPTAMKHGTGRGLPLKDALEYVIPELNIHCLRLALNTP
KVTEQLLKLDEQGLCRKHKVGILYCKAGQSSEEEMYNNEDAGPAFEEFLSLIGEKVCLKG
FTKYAAQLDVKTDSTGTHSLYTTYQDYEIMFHVSTLLPYTPNNRQQLLRKRHIGNDIVTI
IFQEPGALPFTPKNIRSHFQHVFIIVRVHNPCTDNVCYSMAVTRSKDAPPFGPPIPSGTT
FRKSDVFRDFLLAKVINAENAAHKSDKFHTMATRTRQEYLKDLAENCVSNTPIDSTGKFN
LISLTSKKKEKTKARAGAEQHSAGAIAWRVAAQDYAQGVEIDCILGISNEFVVLLDLRTK
EVVFNCYCGDVIGWTPDSSTLKIFYGRGDHIFLQATDGSVEDIREIVQRLKVMTNGWETV
DMTLRRNGLGQLGFHVKYDGTVAEVEDYGFAWQAGLRQGSRLVEICKVAVVTLTHDQMID
LLRTSVTVKVVIIPPFDDGTPRRGWLETYDMNTSEPKTEPESLPPGGRPPYRSNAPWQWS
GPASHNSLPASKWASPSAPGHAQSLSRPPKQTPMVPFREPQPLHSKRPVSFPETPYTASP
AGADKAPPYRQPSGSFSTPGSATYTRYKPSPERYAAAPHPLLSFDPHFSHDGMSSGDSSS
GGLTSQESTMERQKPEPLWHVPAQARLSAMAGSSGSKQASRQDTAGKDSPNRHSKGEPPY
SSHSSSNTLSSNASSSHSDDRWLDPLDPLEPEQDPLSKGGSSDSGIDTTLYTSSPSCMSL
AKVPRQAKPHKPPGTMGLCGGGREAAGRSHHADRRREVSPAPVVAGQTKGYRPKLYSSGS
STPTGLAGGSRDPPRQPSDMSSRAGYPAQVYKTASTETPRPSQLTQSSPFQLSASVPKSF
FSKQPVRNKHPTGWKRTDEPPPRPLPFTDPKKQVDTNTKNVFGQPRLRASLRDLRSPRKN
YKSTIEDDLKKLIIMDNLAPEQERDAGSPQKSLQRTLSDESLCSGRREPSFASPAGLEPG
LPSDVLFTSTCAFPSSTLPARRQHQHPHPPGGGSPSTVPATGNGFPEKKSTISASELSLA
DGRDRPLRRLDPGMMPLPDTAAGLEWSSLVNAAKAYEVQRAVSLFSLNDPALSPEVPPAH
SPVHSHLSLERGPPTPRTTPTMSEEPPLDLTGKVYQLEVMLKQLHTDLQKEKQDKAVLQS
EVASLRQNNQRLQEESQAASEQLRKFAEIFCREKKEL
Download sequence
Identical sequences M3Z2C4
ENSMPUP00000017736 ENSMPUP00000017736 XP_004776311.1.14098 XP_004776312.1.14098 XP_004776314.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]