SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017745 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017745
Domain Number 1 Region: 68-240
Classification Level Classification E-value
Superfamily Bactericidal permeability-increasing protein, BPI 5.23e-22
Family Bactericidal permeability-increasing protein, BPI 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000017745
Domain Number - Region: 22-96
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00288
Family Spectrin repeat 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017745   Gene: ENSMPUG00000017856   Transcript: ENSMPUT00000018005
Sequence length 248
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896916.1:16113702:16124223:-1 gene:ENSMPUG00000017856 transcript:ENSMPUT00000018005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQLWKLVLVCGLIAGTSASLLENLGDNLSNTVNKLKPAVEKGLQTVDNTLDSVVQKLTS
DFKKLQESKAWHLAQEKVQEVKNLVNDALAKITPAKDETMGLNIINSRILKIKAELTPDG
EGINIRVPIVANVTLALPVIGKVNLKASLDLLTAVKVAIDPQTGTPRLIIGKCSSDPDSI
SLTVLDSQNAMIEKAVNTLSSFLTKTMSQLVEKDVCPLIHALLSTVDASLVQDVIDKLQK
ENHPQNDV
Download sequence
Identical sequences M3Z2D3
ENSMPUP00000017745 ENSMPUP00000017745 XP_004746683.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]