SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017792 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017792
Domain Number 1 Region: 2-81
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.03e-25
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 
Domain Number 2 Region: 156-185
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000103
Family LIM domain 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000017792
Domain Number - Region: 186-216
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000356
Family LIM domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017792   Gene: ENSMPUG00000017902   Transcript: ENSMPUT00000018052
Sequence length 814
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897128.1:956265:974799:-1 gene:ENSMPUG00000017902 transcript:ENSMPUT00000018052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSFRDGLAFCAILHRHRPDLLDFNALRKENIYENNKLAFRVAEEELGIPALLDAEDMV
ALKVPDRLSILTYVSQYYNYFHGRSPIGGMAGIKRPSSESSEEPSGKKATSQLARPSPTA
AQEQPLSPANRNPTIQRKDGSSGGLLPKTASPSSSVSSTCGVCGKHVHLVQRHLADGKLY
HRSCFRCKQCSNTLHSGAYRPTGEPGVFVCSSHHPEATSASPTLWTPGPRRPGAVPSDSQ
PRNAPWKAQEANGLRDTGPKARPAALEPVVGKSAAKGVPTPAEPPASASSHVHAGSSAKP
SFSAGLQGGKASMRVANSSPAAWSPLVQDKAAVSPRPALMPSAADSHLATPQGSVTPHVA
APQTKVSVGPASPVPADAPDSTPSASKMQQAREKFFQTPGPTPSPGLAGRVPAPADVASG
DSSREQALSCLRKALPRLGDTGAQLPGRPSPALQSHTSTEGPQASPSAKLAQLAPPRTLS
PPARPELPAPLKVGTTSGAATSSQAGRKSPPVCSGASRASAGSRPKPEAPPLKGMSASPQ
EDPEDGPAGWRARLKPVKKNPAERVLLAEPRTGEALGKAHESSKGPVHVSPTPLLPDKTV
DAARPPPSPSVGKPLGSAGVPSSPGKAVTNATRLPPNYMPPEEIQRQMQDIESQLDALEL
KGVELEKNLRAAEGDASEDALMADWFQLIHEKQLLLRQESELMYKARDQRLVEQQMDLEG
ELRQLMAKPKYLKSLQDQQREEELLSQYISTVDDRSNIVDFLEEDRLRELEEDEMLQNMI
QRLDLQRNSGDQKKKSKFSLSRVLSLRSKSRTPE
Download sequence
Identical sequences M3Z2I0
ENSMPUP00000017792 ENSMPUP00000017792 XP_012903249.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]