SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017795 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017795
Domain Number 1 Region: 67-113
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000563
Family HLH, helix-loop-helix DNA-binding domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017795   Gene: ENSMPUG00000017905   Transcript: ENSMPUT00000018055
Sequence length 154
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896916.1:17400789:17402174:-1 gene:ENSMPUG00000017905 transcript:ENSMPUT00000018055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVASGSAAAAAGPSCALKAGKTAGGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQ
VNVLLYDMNGCYSRLKELVPTLPQNRKVSRVEILQHVIDYIWDLELELNSESQVGTPGGR
GLPARAPLSTLNGEISALAAEAACVPADDRILCR
Download sequence
Identical sequences M3Z2I3
ENSMPUP00000017795 9615.ENSCAFP00000010470 ENSMPUP00000017795 XP_004393078.1.74151 XP_004746745.1.14098 XP_021544817.1.83697 XP_852210.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]