SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017832 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017832
Domain Number 1 Region: 97-193
Classification Level Classification E-value
Superfamily PDZ domain-like 8.81e-19
Family PDZ domain 0.0000885
Further Details:      
 
Domain Number 2 Region: 184-284
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-16
Family PDZ domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017832   Gene: ENSMPUG00000017942   Transcript: ENSMPUT00000018092
Sequence length 287
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896916.1:18766072:18775177:-1 gene:ENSMPUG00000017942 transcript:ENSMPUT00000018092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTLYPSLEDLKMDQAIQAQARAASRMPALPVSQSSVLYPSLEELENYMGLSLSSQEVQQ
KLLQIPEGATTVSSGPSPGQLVAPLSGNSLGTRRAEIKPGVREIHLCKDEHGKTGLRLKA
IDQGLFVQLVKAHSPASLVGLRFGDQILQVDGRDCAGWSTDRAHRVLKRASAEKIIMVVR
DRPFQRTVTMHKDSVGHIGFVLKKGKVVSVVKGSSAAHNGLLTNHAVCEVNGQNVVGLKD
KEVTEILAMAGNVVTLTVIPTVIYEHMVKKLSPTLLHHTMDHSIPAV
Download sequence
Identical sequences M3Z2M0
ENSMPUP00000017832 ENSMPUP00000017832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]