SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017839 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017839
Domain Number 1 Region: 19-117
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-21
Family Caspase recruitment domain, CARD 0.015
Further Details:      
 
Domain Number 2 Region: 1008-1148
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000139
Family Nucleotide and nucleoside kinases 0.0025
Further Details:      
 
Domain Number 3 Region: 679-758
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000232
Family PDZ domain 0.025
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000017839
Domain Number - Region: 178-439
Classification Level Classification E-value
Superfamily Tropomyosin 0.000314
Family Tropomyosin 0.0018
Further Details:      
 
Domain Number - Region: 791-838
Classification Level Classification E-value
Superfamily SH3-domain 0.0282
Family SH3-domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017839   Gene: ENSMPUG00000017950   Transcript: ENSMPUT00000018100
Sequence length 1153
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897128.1:2071118:2111994:-1 gene:ENSMPUG00000017950 transcript:ENSMPUT00000018100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGGPEMDDYMETLKDEEDALWENVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEV
LNAPMLPSKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYKLVTGKEPTRRFSTIVV
EEGHEGLTHFLMNEVIKLQQQMKAKDLQRCELLAKSRQLEDEKKQLTLTRVELLTFQERY
YKMKEERDSYNDELVKVKDDNYNLAMRYAQLSEEKNMAVMRSRDLQLEIDQLKHRLNKVE
EECKLERNQSLKLKNDIENRPKREQVLELERENEMLKTKIQELQSIIQAGKRSLPDSDKA
ILDILEHDRKEALEDRQDLVNKIYNLQEEVRQAEELRDKYLEEKEDLELKCSTLGKDCEM
YKHRMNTVMLQLEEVERERDQAFHSRDEAQTQYSQCLIEKDKYRKQIRELEEKHDEMRIE
MVRREACIVNLESKLRRLSKDSSSLEQSLPRNLPVAIISQNFGDASPRTNGQEADDSSTS
EESPEDSRYFLPYHPPKRRMNLKGIQLQRAKSPISLKRASDFQGRGHEEEGTDASPSSSR
SLPITNSFSKTPHRSRSSIMSITAEPPGNDSILRRYKEDAPHRSTVEEDNDSGGFDVLDF
DDDSHEHCSFGPPSIHSSSSSHQSEGLDAYDLEQVNLMFRKFSLERPFRPSVTSVGHVRG
PGPSVQHTTLNSDSLTSQLTLLGGNTRGSFVHAVKPGSLAEKAGLREGHELLLVEGCIKG
ERQSVPLDTCTKEEVHWTIQRCSGPITLHYKLNQEGYRKLLKDMEEGLITSGDSFYIRLN
LNISSQLDACSLSLKCDDIVHVIDTMYQDRHEWLCARVDPFTKHDLDVGTIPSYSRAQQL
LLVKLQRLMHRGNREETDNTHHTLRALRNTLQPEEPLSTSDPRVSPRLSRASFLFGQLLQ
FVSRSENKYKRMNSNERVRIVSGSPLGSLTRTSLDATKLLTEKQEEMDPESELSKNLSLI
PYSPVHSLHCERRRPVLFTPTMLAKALVQKLLNSGGAMEFTMCKPDVVTRDEFLRKQKTE
TIIYSREKNPNTFECIVPANIEAVAAKDKHCLLEAGISCTRDLIKSRIYPIVLFIRVSEK
NIKRFRKMLPRPETEEEFLRLCRLKEKELEALPCLYATVEADMWGSVEELLRVLKDKISE
EQRKTIWVDEGQL
Download sequence
Identical sequences M3Z2M7
ENSMPUP00000017839 ENSMPUP00000017839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]