SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017884 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017884
Domain Number 1 Region: 3-100
Classification Level Classification E-value
Superfamily PH domain-like 5.74e-31
Family VPS36 N-terminal domain-like 0.00000234
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000017884
Domain Number - Region: 158-238
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000326
Family Nudix-associated domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017884   Gene: ENSMPUG00000017995   Transcript: ENSMPUT00000018145
Sequence length 238
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897107.1:21:26000:-1 gene:ENSMPUG00000017995 transcript:ENSMPUT00000018145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKFDAGTLLLSTHRLIWRDQKNHECCMAIPLSQIVFIEEQAAGIGKSAKIVVHLHPAPP
NKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSLQTNRGPQPGRI
RAVGIVGIERKLEEKRKETDKNISEAFEDLSKLMVKAKEMVELSKSIANKIKDKQGDITE
DETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGMLQAPLEERGGIMSLTEV
Download sequence
Identical sequences M3Z2S2
ENSMPUP00000017884 ENSMPUP00000017884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]