SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017916 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017916
Domain Number 1 Region: 481-671
Classification Level Classification E-value
Superfamily Sec7 domain 2.75e-65
Family Sec7 domain 0.00000544
Further Details:      
 
Domain Number 2 Region: 679-811
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000636
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017916   Gene: ENSMPUG00000018027   Transcript: ENSMPUT00000018177
Sequence length 1015
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897084.1:154288:225155:1 gene:ENSMPUG00000018027 transcript:ENSMPUT00000018177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNETVLHQFCCPAADAEQKPACSDLASQSDGSCTQAGGGMEDSVVAAAAVAAGRPSAHAP
KAQAQELQQEEERPGAGGASPRAGSHRVASPGRQQPALATALCSHAPNASDYELSLDLKN
KQIEMLEHKYGGHLVSRRAACTIQTAFRQYQLSKNFEKIRNSLLESRLPRRISLRKVRAP
TAESLAAEKALMEGYGLMGLPLVRSPSLPPTFAGTLTELEDSFTEQVQSLAKSIDDALST
WSLKTMCSLQESGAYQLHQALHAGTGPPGLEAEMRELDSARPAPAPGEETAEAAGLPQGH
GSTLMMAFRDVTVQIANQNISVSSATALSVANCLGTQTAQAPAEPAAGKAEQEEAPGQEA
SVATTAAQGDVPAENTGAEAGASGAPSTHPPGAVVEALVEGAAVAAEAEVGEVGKGTEAE
AGDNSEPLSSSSTSTKSAKSGSEASASASKEALQAMILSLPRYHCENPASCKSPTLSTDT
LRKRLYRIGLNLFNINPDKGIQFLISRGFIPDTPIGVAHFLLQRKGLSRQMIGEFLGNSK
KQFNRDVLDCVVDEMDFSSMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCMCNPEV
VQQFHNPDTIFILAFAIILLNTDMYSPNIKPDRKMMLEDFIRNLRGVDDGADIPRELVVG
IYERIQQKELKSNEDHVTYVTKVEKSIVGMKTVLSVPHRRLVCCSRLFEVTDVNKLQKQA
AHQREVFLFNDLLVILKLCPKKKSSSTYTFCKSVGLLGMQFHLFENEYYSHGITLVTPLS
GSEKKQVLHFCALGSDEMQKFVEDLKESIAEVTELEQIRIEWELEKQQGAKTLSFKSSGA
QVDPQSKQGSPTVKAKREAALGEKPVESTVEVSIHNRLQTSQHNPGLGAERGAPAPPPDP
QPSPLREQPPLLPPLPPTPPGTLVQCQQIVKVIVLDKPCLARMEPLLSQALSCYASSSSD
SCGSTPLGGPGSPVKVIHQPPLPPPPPPYNHPHQYCPPGSLLHRRRYSSGSRSLV
Download sequence
Identical sequences M3Z2V4
ENSMPUP00000017916 ENSMPUP00000017916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]